UQCC2 Polyclonal antibody

UQCC2 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 25781-1-AP

Publications(3)

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

C6orf125, Breast cancer-associated protein SGA-81M, Mitochondrial nucleoid factor 1, Mitochondrial protein M19, MNF1

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIHCIF/ICC

WB analysis of HEK-293 using 25781-1-AP
HEK-293 cells were subjected to SDS PAGE followed by western blot with 25781-1-AP (UQCC2 antibody at dilution of 1:600 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human liver cancer using 25781-1-AP
Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 25781-1-AP (UQCC2 antibody at dilution of 1:50 (under 10x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human liver cancer using 25781-1-AP
Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 25781-1-AP (UQCC2 antibody at dilution of 1:50 (under 40x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human breast cancer using 25781-1-AP
Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 25781-1-AP (UQCC2 antibody at dilution of 1:50 (under 10x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human breast cancer using 25781-1-AP
Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 25781-1-AP (UQCC2 antibody at dilution of 1:50 (under 40x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of MCF-7 using 25781-1-AP
Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using UQCC2 antibody (25781-1-AP) at dilution of 1:400 and CoraLite®594-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-4).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Overview

Tested Applications
Product Information
Publications (3)
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	HEK-293 cells
Positive IHC detected in	human liver cancer tissue, human breast cancer tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***
Positive IF/ICC detected in	MCF-7 cells

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:500-1:1000
Immunohistochemistry (IHC)	IHC : 1:20-1:200
Immunofluorescence (IF)/ICC	IF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

25781-1-AP targets UQCC2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

Tested Reactivity	human
Cited Reactivity	human, mouse
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag22710 Product name: Recombinant human C6orf125 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-126 aa of BC006007 Sequence: MAASRYRRFLKLCEEWPVDETKRGRDLGAYLRQRVAQAFREGENTQVAEPEACDQMYESLARLHSNYYKHKYPRPRDTSFSGLSLEEYKLILSTDTLEELKEIDKGMWKKLQEKFAPKGPEEDHKA Predict reactive species
Full Name	chromosome 6 open reading frame 125
Calculated Molecular Weight	126 aa, 15 kDa
Observed Molecular Weight	14 kDa
GenBank Accession Number	BC006007
Gene Symbol	UQCC2
Gene ID (NCBI)	84300
RRID	AB_2880237
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q9BRT2
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

UQCC2, also named as C6orf125, MNF1, Mitochondrial protein M19 and Breast cancer-associated protein SGA-81M, plays a role in the modulation of respiratory chain activities. It's a mitochondrial protein.

Protocols

Product Specific Protocols
IF protocol for UQCC2 antibody 25781-1-AP	Download protocol
IHC protocol for UQCC2 antibody 25781-1-AP	Download protocol
WB protocol for UQCC2 antibody 25781-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

Species	Application	Title
human	WB	Oxid Med Cell Longev Combined Respiratory Chain Deficiency and UQCC2 Mutations in Neonatal Encephalomyopathy: Defective Supercomplex Assembly in Complex III Deficiencies. Authors - René G Feichtinger View Article
mouse	WB	Cell Rep A PKD-MFF signaling axis couples mitochondrial fission to mitotic progression. Authors - Evanthia Pangou View Article
human	WB	iScience Deficient tRNA posttranscription modification dysregulated the mitochondrial quality controls and apoptosis Authors - Yunfan He View Article