Tested Applications
Positive WB detected in | HeLa cells, MCF-7 cells |
Positive IHC detected in | human heart tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 2 publications below |
IHC | See 1 publications below |
Product Information
14793-1-AP targets UQCR in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag6491 Product name: Recombinant human UQCR protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-56 aa of BC000462 Sequence: MVTRFLGPRYRELVKNWVPTAYTWGAVGAVGLVWATDWRLILDWVPYINGKFKKDN Predict reactive species |
Full Name | ubiquinol-cytochrome c reductase, 6.4kDa subunit |
Calculated Molecular Weight | 6 kDa |
Observed Molecular Weight | 6 kDa |
GenBank Accession Number | BC000462 |
Gene Symbol | UQCR |
Gene ID (NCBI) | 10975 |
RRID | AB_1557751 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | O14957 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for UQCR antibody 14793-1-AP | Download protocol |
IHC protocol for UQCR antibody 14793-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Cell Stem Cell Selective translation of nuclear mitochondrial respiratory proteins reprograms succinate metabolism in AML development and chemoresistance | ||
Cell Discov NUDT21 lactylation reprograms alternative polyadenylation to promote cuproptosis resistance |