Tested Applications
Positive WB detected in | A549 cells, HepG2 cells, mouse liver tissue, human placenta tissue |
Positive IP detected in | HepG2 cells |
Positive IHC detected in | mouse liver tissue, human hepatocirrhosis tissue, human liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 1 publications below |
WB | See 2 publications below |
Product Information
15285-1-AP targets URM1 in WB, IP, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag7448 Product name: Recombinant human URM1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-101 aa of BC003581 Sequence: MAAPLSVEVEFGGGAELLFDGIKKHRVTLPGQEEPWDIRNLLIWIKKNLLKERPELFIQGDSVRPGILVLINDADWELLGELDYQLQDQDSVLFISTLHGG Predict reactive species |
Full Name | ubiquitin related modifier 1 homolog (S. cerevisiae) |
Calculated Molecular Weight | 11 kDa |
Observed Molecular Weight | 11 kDa |
GenBank Accession Number | BC003581 |
Gene Symbol | URM1 |
Gene ID (NCBI) | 81605 |
RRID | AB_2213808 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q9BTM9 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for URM1 antibody 15285-1-AP | Download protocol |
IHC protocol for URM1 antibody 15285-1-AP | Download protocol |
IP protocol for URM1 antibody 15285-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Mol Cell Biol Human AlkB homolog ABH8 Is a tRNA methyltransferase required for wobble uridine modification and DNA damage survival.
| ||
Hum Mol Genet Cytosolic HSC20 integrates de novo iron-sulfur cluster biogenesis with the CIAO1-mediated transfer to recipients. |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Ana Paula (Verified Customer) (08-03-2022) | mESC derived motor neurons 1:1000 primary ab in blocking buffer ON at 4 C 1:10000 secondary ab in TBS 1h at RT
![]() |