Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

URM1 Polyclonal antibody

URM1 Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 15285-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, ELISA

C9orf74, Ubiquitin-related modifier 1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA549 cells, HepG2 cells, mouse liver tissue, human placenta tissue
Positive IP detected inHepG2 cells
Positive IHC detected inmouse liver tissue, human hepatocirrhosis tissue, human liver tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

15285-1-AP targets URM1 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag7448

Product name: Recombinant human URM1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-101 aa of BC003581

Sequence: MAAPLSVEVEFGGGAELLFDGIKKHRVTLPGQEEPWDIRNLLIWIKKNLLKERPELFIQGDSVRPGILVLINDADWELLGELDYQLQDQDSVLFISTLHGG

Predict reactive species
Full Name ubiquitin related modifier 1 homolog (S. cerevisiae)
Calculated Molecular Weight 11 kDa
Observed Molecular Weight 11 kDa
GenBank Accession NumberBC003581
Gene Symbol URM1
Gene ID (NCBI) 81605
RRIDAB_2213808
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9BTM9
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Urm1 (ubiquitin related modifier 1) is a molecular fossil in the class of ubiquitin-like proteins (UBLs). It encompasses characteristics of classical UBLs, such as ubiquitin or SUMO (small ubiquitin-related modifier), but also of bacterial sulfur-carrier proteins (SCP) (PMID: 33499055). By the assistance of an E1-like activation enzyme Uba4, Urm1 can function as a modifier to target proteins, called urmylation (PMID: 33548388). The ubiquitin-like protein Urm1 can be covalently conjugated to other proteins, such as the yeast thioredoxin peroxidase protein Ahp1p, through a mechanism involving the ubiquitin E1-like enzyme Uba4 (PMID: 19047990).

Protocols

Product Specific Protocols
IHC protocol for URM1 antibody 15285-1-APDownload protocol
IP protocol for URM1 antibody 15285-1-APDownload protocol
WB protocol for URM1 antibody 15285-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle

Cell Death Discov

Histidine to glutamine substitutants, a regulated process that impacts cell survival and suggests histidine shortage in cancer.

Authors - Domenica Lovecchio
humanWB

Mol Cell Biol

Human AlkB homolog ABH8 Is a tRNA methyltransferase required for wobble uridine modification and DNA damage survival.

Authors - Fu Dragony D
  • KD Validated
humanWB

Hum Mol Genet

Cytosolic HSC20 integrates de novo iron-sulfur cluster biogenesis with the CIAO1-mediated transfer to recipients.

Authors - Ki Soon Kim
humanWB

NAR Cancer

Exploiting nanopore sequencing advances for tRNA sequencing of human cancer models.

Authors - Adva Kochavi

Reviews

    5.0 out of 5
Add a review

1 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Ana Paula (Verified Customer) (08-03-2022)

mESC derived motor neurons 1:1000 primary ab in blocking buffer ON at 4 C 1:10000 secondary ab in TBS 1h at RT

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: mESC derived motor neurons
URM1 Antibody Western Blot validation (1:1000 dilution) in mESC derived motor neurons (Cat no:15285-1-AP)
Loading...
||
New chat

Able

正在加载,请稍候...