Use Able AI chat for product recommendations
  • KD/KO Validated

VAMP2 Polyclonal antibody

VAMP2 Polyclonal Antibody for WB, IHC, IF-P, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, ELISA, Blocking

SYB2, Synaptobrevin 2, Synaptobrevin-2, VAMP 2, VAMP-2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for VAMP2 in ?

Tested Applications

Positive WB detected inmouse brain tissue, fetal human brain tissue, PC-12 cells, rat brain tissue
Positive IHC detected inmouse brain tissue, human skeletal muscle tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse eye tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:5000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10135-1-AP targets VAMP2 in WB, IHC, IF-P, ELISA, Blocking applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0179

Product name: Recombinant human VAMP2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-116 aa of BC002737

Sequence: MSATAATAPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKMMIILGVICAIILIIIIVYFST

Predict reactive species
Full Name vesicle-associated membrane protein 2 (synaptobrevin 2)
Calculated Molecular Weight 13 kDa
Observed Molecular Weight 19 kDa
GenBank Accession NumberBC002737
Gene Symbol VAMP2
Gene ID (NCBI) 6844
RRIDAB_2256918
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP63027
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

VAMP2 (vesicle-associated membrane protein 2), also named as synaptobrevin 2, is a member of the SNARE (soluble NSF-attachment protein receptor) family proteins. Characterized by a common sequence called the SNARE motif, SNARE proteins are involved in membrane fusion and vesicular transport (PMID: 11252968). VAMP2, with a molecular mass of 15-19 kDa, consists of a short N-terminal sequence, a SNARE motif, and a C-terminal transmembrane region. It is required for fast calcium-triggered synaptic vesicle fusion. VAMP2 forms a stable complex with STX1 (syntaxin 1) and SNAP25 (synaptosomal-associated protein 25) during synaptic vesicle fusion (PMID: 16793874). It also forms a distinct complex with synaptophysin. VAMP2 is expressed in nervous system and some non-neuronal tissues, such as skeletal muscle (PMID: 18570252).

Protocols

Product Specific Protocols
IF protocol for VAMP2 antibody 10135-1-APDownload protocol
IHC protocol for VAMP2 antibody 10135-1-APDownload protocol
WB protocol for VAMP2 antibody 10135-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The VAMP2 Polyclonal antibody (Cat# 10135-1-AP) has 35 citations across 25 journals, including Nature Neuroscience, Neuron, Science Advances, PNAS, EMBO Journal, Cell Reports, Oncogene, and Journal of Biological Chemistry. Research fields span neuroscience (synaptic vesicle fusion, neurodegeneration in Alzheimer's and Parkinson's disease), SNARE complex biology, lipid and glucose metabolism, cancer (hepatocellular carcinoma, glioma), endocrinology (insulin secretion), and cardiovascular disease.

SpeciesApplicationTitle
mouseWB

Nat Aging

GDF1 ameliorates cognitive impairment induced by hearing loss

Authors - Lina Pan
mouseWB

Nat Neurosci

Aerobic glycolysis is the predominant means of glucose metabolism in neuronal somata, which protects against oxidative damage

Authors - Yao Wei

Nat Neurosci

UBQLN2 links proteotoxicity with lipid metabolism in neurodegeneration

Authors - Yang Liu

Neuron

Aggregation and propagation of TAF15 trigger neurodegeneration.

Authors - Lanxia Meng
IF

Neuron

Rapid Cue-Specific Remodeling of the Nascent Axonal Proteome.

Authors - Roberta Cagnetta
humanWB,IF

Adv Sci (Weinh)

Early Endosomes Act as Local Exocytosis Hubs to Repair Endothelial Membrane Damage

Authors - Nikita Raj
Loading...
||
New chat

Able™

正在加载,请稍候...