Tested Applications
| Positive WB detected in | mouse brain tissue, fetal human brain tissue, PC-12 cells, rat brain tissue |
| Positive IHC detected in | mouse brain tissue, human skeletal muscle tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse eye tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:5000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
10135-1-AP targets VAMP2 in WB, IHC, IF-P, ELISA, Blocking applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0179 Product name: Recombinant human VAMP2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-116 aa of BC002737 Sequence: MSATAATAPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKMMIILGVICAIILIIIIVYFST Predict reactive species |
| Full Name | vesicle-associated membrane protein 2 (synaptobrevin 2) |
| Calculated Molecular Weight | 13 kDa |
| Observed Molecular Weight | 19 kDa |
| GenBank Accession Number | BC002737 |
| Gene Symbol | VAMP2 |
| Gene ID (NCBI) | 6844 |
| RRID | AB_2256918 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P63027 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
VAMP2 (vesicle-associated membrane protein 2), also named as synaptobrevin 2, is a member of the SNARE (soluble NSF-attachment protein receptor) family proteins. Characterized by a common sequence called the SNARE motif, SNARE proteins are involved in membrane fusion and vesicular transport (PMID: 11252968). VAMP2, with a molecular mass of 15-19 kDa, consists of a short N-terminal sequence, a SNARE motif, and a C-terminal transmembrane region. It is required for fast calcium-triggered synaptic vesicle fusion. VAMP2 forms a stable complex with STX1 (syntaxin 1) and SNAP25 (synaptosomal-associated protein 25) during synaptic vesicle fusion (PMID: 16793874). It also forms a distinct complex with synaptophysin. VAMP2 is expressed in nervous system and some non-neuronal tissues, such as skeletal muscle (PMID: 18570252).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for VAMP2 antibody 10135-1-AP | Download protocol |
| IHC protocol for VAMP2 antibody 10135-1-AP | Download protocol |
| WB protocol for VAMP2 antibody 10135-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The VAMP2 Polyclonal antibody (Cat# 10135-1-AP) has 35 citations across 25 journals, including Nature Neuroscience, Neuron, Science Advances, PNAS, EMBO Journal, Cell Reports, Oncogene, and Journal of Biological Chemistry. Research fields span neuroscience (synaptic vesicle fusion, neurodegeneration in Alzheimer's and Parkinson's disease), SNARE complex biology, lipid and glucose metabolism, cancer (hepatocellular carcinoma, glioma), endocrinology (insulin secretion), and cardiovascular disease.
| Species | Application | Title |
|---|---|---|
Nat Neurosci Aerobic glycolysis is the predominant means of glucose metabolism in neuronal somata, which protects against oxidative damage | ||
Adv Sci (Weinh) Early Endosomes Act as Local Exocytosis Hubs to Repair Endothelial Membrane Damage |
