Tested Applications
Positive WB detected in | human lung tissue, mouse kidney tissue, Human peripheral blood leukocyte cells |
Positive IHC detected in | human lung cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:200-1:1000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 2 publications below |
IHC | See 1 publications below |
Product Information
11822-1-AP targets VAMP5 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag2390 Product name: Recombinant human VAMP5 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-116 aa of BC017891 Sequence: MAGIELERCQQQANEVTEIMRNNFGKVLERGVKLAELQQRSDQLLDMSSTFNKTTQNLAQKKCWENIRYRICVGLVVVGVLLIILIVLLVVFLPQSSDSSSAPRTQDAGIASGPGN Predict reactive species |
Full Name | vesicle-associated membrane protein 5 (myobrevin) |
Calculated Molecular Weight | 12.8 kDa |
Observed Molecular Weight | 13-15 kDa |
GenBank Accession Number | BC017891 |
Gene Symbol | VAMP5 |
Gene ID (NCBI) | 10791 |
RRID | AB_2212965 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | O95183 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
VAMP5, also known as myobrevin, is a member of the vesicle-associated membrane protein (VAMP)/synaptobrevin family and the SNARE superfamily. Characterized by a common sequence called the SNARE motif, SNARE proteins are involved in membrane fusion and vesicular transport (PMID: 11252968). VAMP5 may participate in trafficking events that are associated with myogenesis, such as myoblast fusion and/or GLUT4 trafficking.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for VAMP5 antibody 11822-1-AP | Download protocol |
IHC protocol for VAMP5 antibody 11822-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Front Immunol Immune Gene Signatures and Immunotypes in Immune Microenvironment Are Associated With Glioma Prognose. | ||
Front Mol Neurosci Construction and validation of a risk model based on the key SNARE proteins to predict the prognosis and immune microenvironment of gliomas |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Boyan (Verified Customer) (06-19-2020) | This antibody labels a ~ 25 kD band, but not a 15 kD band, in 293T cell lysate - not sure is this a nonspecific band or a special version of this protein in 293T cells.
|