Tested Applications
Positive IHC detected in | human liver cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
24659-1-AP targets VN1R3 in IHC, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag20382 Product name: Recombinant human VN1R3 protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 242-311 aa of BC107074 Sequence: STLCYFTRSPPSLHMSLFPNPSWWLLNTSALITACFPMVSPFVLMSRHPRIPRLGSACCGRNPQFPKLVR Predict reactive species |
Full Name | vomeronasal 1 receptor 3 pseudogene |
Calculated Molecular Weight | 311 aa, 35 kDa |
GenBank Accession Number | BC107074 |
Gene Symbol | VN1R3 |
Gene ID (NCBI) | 317702 |
RRID | AB_2879660 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q9BXE9 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
VN1R3, also named as V1RL3, is a pheromone receptor. We always got 55-65 kDa in our detection.
Protocols
Product Specific Protocols | |
---|---|
IHC protocol for VN1R3 antibody 24659-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |