Tested Applications
| Positive WB detected in | human brain tissue, human testis tissue, mouse brain tissue, mouse liver tissue, PC-3 cells |
| Positive IP detected in | mouse brain tissue |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2400 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 2 publications below |
| WB | See 4 publications below |
| IP | See 1 publications below |
Product Information
15079-1-AP targets VPS8 in WB, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag7151 Product name: Recombinant human VPS8 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 56-147 aa of BC001001 Sequence: MSPSYHQSKGDPTAKKGTSEPVLDPQQIQAFDQLCRLYRGSSRLALLTELSQNRSSESYRPFSGSQSAPAFNSIFQNENFQLQLIPPPVTED Predict reactive species |
| Full Name | vacuolar protein sorting 8 homolog (S. cerevisiae) |
| Calculated Molecular Weight | 162 kDa |
| Observed Molecular Weight | 151 kDa |
| GenBank Accession Number | BC001001 |
| Gene Symbol | VPS8 |
| Gene ID (NCBI) | 23355 |
| RRID | AB_2215543 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q8N3P4 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
VPS8, also named as KIAA0804, has some isoforms with MW 135-160 kDa and 70-90 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for VPS8 antibody 15079-1-AP | Download protocol |
| IP protocol for VPS8 antibody 15079-1-AP | Download protocol |
| WB protocol for VPS8 antibody 15079-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Elife Capping protein regulates endosomal trafficking by controlling F-actin density around endocytic vesicles and recruiting RAB5 effectors.
| ||
Traffic Mammalian CORVET is required for fusion and conversion of distinct early endosome sub-populations. | ||
Sci Rep HOPS, CORVET and newly-identified Hybrid tethering complexes contribute differentially towards multiple modes of endocytosis
|















