• KD/KO Validated

VILIP1 Polyclonal antibody

VILIP1 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 13919-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

VILIP 1, VILIP-1, VSNL1, Hippocalcin like protein 3, Hippocalcin-like protein 3

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse brain tissue, HeLa cells, HepG2 cells, human brain tissue, mouse tongue tissue, rat brain tissue, mouse cerebellum tissue
Positive IP detected inmouse brain tissue
Positive IHC detected inHuman bowens disease
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:1000-1:4000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

13919-1-AP targets VILIP1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag4923

Product name: Recombinant human VSNL1 protein

Source: e coli.-derived, T-HIS

Tag: 6*His

Domain: 1-191 aa of BC022012

Sequence: MGKQNSKLAPEVMEDLVKSTEFNEHELKQWYKGFLKDCPSGRLNLEEFQQLYVKFFPYGDASKFAQHAFRTFDKNGDGTIDFREFICALSITSRGSFEQKLNWAFNMYDLDGDGKITRVEMLEIIEAIYKMVGTVIMMKMNEDGLTPEQRVDKIFSKMDKNKDDQITLDEFKEAAKSDPSIVLLLQCDIQK

Predict reactive species
Full Name visinin-like 1
Calculated Molecular Weight 22 kDa
Observed Molecular Weight 18-24 kDa
GenBank Accession NumberBC022012
Gene Symbol VSNL1
Gene ID (NCBI) 7447
RRIDAB_2215851
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP62760
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Visinin-like protein 1 (VILIP1) is also named VLP-1, hippocalcin-like protein 3 (HLP3), VSNL1 and VISL1. The neuronal calcium sensor protein VILIP1 forms a complex with neurotransmitter-gated P2X2 receptors, functions as a channel regulator, and likely binds more tightly to P2X2 receptors in an activation- and calcium-dependent manner (PMID: 18922787). VILIP1 is widely expressed and involved in physiological and disease processes throughout the body, including tumor formation (PMID: 17311005, PMID: 18301774). VILIP1 is localized primarily in the rat hippocampus, where it controls neuronal excitability important for learning and memory (PMID: 18440708, PMID: 15336574). In particular, VILIP1 binds to the α-subunit of the α4β2 nicotinic acetylcholine receptor (nAChR), which promotes its surface expression and trafficking in oocytes and hippocampal neurons (PMID: 1220248, PMID: 19063970).

Protocols

Product Specific Protocols
IF protocol for VILIP1 antibody 13919-1-APDownload protocol
IHC protocol for VILIP1 antibody 13919-1-APDownload protocol
IP protocol for VILIP1 antibody 13919-1-APDownload protocol
WB protocol for VILIP1 antibody 13919-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouse,humanWB,IF

Free Radic Biol Med

Dimerization of visinin-like-protein 1 is regulated by oxidative stress and calcium and is a pathological hallmark of amyotrophic lateral sclerosis.

Authors - Martina P Liebl
mouseWB

Front Cell Neurosci

Lack of Helios During Neural Development Induces Adult Schizophrenia-Like Behaviors Associated With Aberrant Levels of the TRIF-Recruiter Protein WDFY1.

Authors - Anna Sancho-Balsells
mouseWB

Sci Rep

Proteomic profile of human sinoatrial and atrioventricular nodes in comparison to working myocardium

Authors - Agata Krawczyk-Ożóg

Signal Transduct Target Ther

Visinin-like protein 1 disrupts calcium homeostasis and promotes atrial fibrillation in human and rodent models

Authors - Ke Xiong
Loading...
||
New chat

Able

正在加载,请稍候...