Tested Applications
| Positive WB detected in | mouse brain tissue, HeLa cells, HepG2 cells, human brain tissue, mouse tongue tissue, rat brain tissue, mouse cerebellum tissue |
| Positive IP detected in | mouse brain tissue |
| Positive IHC detected in | Human bowens disease Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
13919-1-AP targets VILIP1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag4923 Product name: Recombinant human VSNL1 protein Source: e coli.-derived, T-HIS Tag: 6*His Domain: 1-191 aa of BC022012 Sequence: MGKQNSKLAPEVMEDLVKSTEFNEHELKQWYKGFLKDCPSGRLNLEEFQQLYVKFFPYGDASKFAQHAFRTFDKNGDGTIDFREFICALSITSRGSFEQKLNWAFNMYDLDGDGKITRVEMLEIIEAIYKMVGTVIMMKMNEDGLTPEQRVDKIFSKMDKNKDDQITLDEFKEAAKSDPSIVLLLQCDIQK Predict reactive species |
| Full Name | visinin-like 1 |
| Calculated Molecular Weight | 22 kDa |
| Observed Molecular Weight | 18-24 kDa |
| GenBank Accession Number | BC022012 |
| Gene Symbol | VSNL1 |
| Gene ID (NCBI) | 7447 |
| RRID | AB_2215851 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P62760 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Visinin-like protein 1 (VILIP1) is also named VLP-1, hippocalcin-like protein 3 (HLP3), VSNL1 and VISL1. The neuronal calcium sensor protein VILIP1 forms a complex with neurotransmitter-gated P2X2 receptors, functions as a channel regulator, and likely binds more tightly to P2X2 receptors in an activation- and calcium-dependent manner (PMID: 18922787). VILIP1 is widely expressed and involved in physiological and disease processes throughout the body, including tumor formation (PMID: 17311005, PMID: 18301774). VILIP1 is localized primarily in the rat hippocampus, where it controls neuronal excitability important for learning and memory (PMID: 18440708, PMID: 15336574). In particular, VILIP1 binds to the α-subunit of the α4β2 nicotinic acetylcholine receptor (nAChR), which promotes its surface expression and trafficking in oocytes and hippocampal neurons (PMID: 1220248, PMID: 19063970).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for VILIP1 antibody 13919-1-AP | Download protocol |
| IHC protocol for VILIP1 antibody 13919-1-AP | Download protocol |
| IP protocol for VILIP1 antibody 13919-1-AP | Download protocol |
| WB protocol for VILIP1 antibody 13919-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The VILIP1 Polyclonal antibody (Cat# 13919-1-AP) has 4 citations published in Signal Transduction and Targeted Therapy, Free Radical Biology and Medicine, Scientific Reports, and Frontiers in Cellular Neuroscience. Research fields span cardiac electrophysiology and atrial fibrillation, neurodegeneration (ALS), cardiac node proteomics, and neuroscience (schizophrenia-related neural development).
| Species | Application | Title |
|---|---|---|
Signal Transduct Target Ther Visinin-like protein 1 disrupts calcium homeostasis and promotes atrial fibrillation in human and rodent models | ||
Free Radic Biol Med Dimerization of visinin-like-protein 1 is regulated by oxidative stress and calcium and is a pathological hallmark of amyotrophic lateral sclerosis. | ||
Sci Rep Proteomic profile of human sinoatrial and atrioventricular nodes in comparison to working myocardium | ||
Front Cell Neurosci Lack of Helios During Neural Development Induces Adult Schizophrenia-Like Behaviors Associated With Aberrant Levels of the TRIF-Recruiter Protein WDFY1. |
