Published Applications
| KD/KO | See 2 publications below |
| WB | See 16 publications below |
Product Information
51143-1-AP targets Vpr in WB, ELISA applications and shows reactivity with immunodeficiency virus 1 samples.
| Tested Reactivity | immunodeficiency virus 1 |
| Cited Reactivity | human, virus |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0718 Product name: Recombinant Vpr protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-96 aa of NP_057852 Sequence: MEQAPEDQGPQREPHNEWTLELLEELKNEAVRHFPRIWLHGLGQHIYETYGDTWAGVEAIIRILQQLLFIHFRIGCRHSRIGVTRQRRARNGASR Predict reactive species |
| Full Name | Vpr |
| Calculated Molecular Weight | 11 kDa |
| GenBank Accession Number | NP_057852 |
| Gene Symbol | |
| Gene ID (NCBI) | |
| RRID | AB_10695191 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
This antibody recognize the VPR gene of Human immunodeficiency virus 1.
Publications
| Species | Application | Title |
|---|---|---|
Nat Commun HIV reprograms host m 6 Am RNA methylome by viral Vpr protein-mediated degradation of PCIF1 | ||
Proc Natl Acad Sci U S A CHAF1A/B mediate silencing of unintegrated HIV-1 DNAs early in infection. | ||
Retrovirology A functional conserved intronic G run in HIV-1 intron 3 is critical to counteract APOBEC3G-mediated host restriction.
| ||
J Biol Chem HIV-1 Vpr enhances proteasomal degradation of MCM10 through the Cul4-DDB1[VprBP] E3 ubiquitin ligase to induce G2/M cell cycle arrest. | ||
J Biol Chem HIV-1 Vpr Protein Induces Proteasomal Degradation of Chromatin-associated Class I HDACs to Overcome Latent Infection of Macrophages. |
