Filter: AllWBIHC

WB analysis of mouse brain using 21280-1-AP
mouse brain tissue were subjected to SDS PAGE followed by western blot with 21280-1-AP (WBSCR17 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
WB analysis of human brain using 21280-1-AP
human brain tissue were subjected to SDS PAGE followed by western blot with 21280-1-AP (WBSCR17 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.
WB analysis of mouse lung using 21280-1-AP
mouse lung tissue were subjected to SDS PAGE followed by western blot with 21280-1-AP (WBSCR17 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
WB analysis of A549 using 21280-1-AP
A549 cells were subjected to SDS PAGE followed by western blot with 21280-1-AP (WBSCR17 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
IHC staining of human brain using 21280-1-AP
Immunohistochemical analysis of paraffin-embedded human brain using 21280-1-AP (WBSCR17 antibody) at dilution of 1:100 (under 10x lens).
IHC staining of human brain using 21280-1-AP
Immunohistochemical analysis of paraffin-embedded human brain using 21280-1-AP (WBSCR17 antibody) at dilution of 1:100 (under 40x lens).
IHC staining of human heart using 21280-1-AP
Immunohistochemical analysis of paraffin-embedded human heart using 21280-1-AP (WBSCR17 antibody) at dilution of 1:100 (under 10x lens).
IHC staining of human heart using 21280-1-AP
Immunohistochemical analysis of paraffin-embedded human heart using 21280-1-AP (WBSCR17 antibody) at dilution of 1:100 (under 40x lens).

WBSCR17 Polyclonal antibody

Name: WBSCR17 Polyclonal antibody
Brand: Proteintech
SKU: 21280-1-AP
Rating: 5.00 (1 reviews)

WBSCR17 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 21280-1-AP

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

EC:2.4.1.41, GalNAc T like protein 3, GalNAc-T-like protein 3, GALNT17, Polypeptide GalNAc transferase-like protein 3

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information
Protocols
Reviews (1)

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	mouse brain tissue, A549 cells, mouse lung tissue, human brain tissue
Positive IHC detected in	human brain tissue, human heart tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:500-1:2000
Immunohistochemistry (IHC)	IHC : 1:20-1:200
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

21280-1-AP targets WBSCR17 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag15792 Product name: Recombinant human WBSCR17 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-126 aa of BC069624 Sequence: MASLRRVKVLLVLNLIAVAGFVLFLAKCRPIAVRSGDAFHEIRPRAEVANLSAHSASPIQDAVLKRLSLLEDIVYRQLNGLSKSLGLIEGYGGRGKGGLPATLSPAEEEKAKGPHEKYGYNSYLSE Predict reactive species
Full Name	Williams-Beuren syndrome chromosome region 17
Calculated Molecular Weight	598 aa, 68 kDa
Observed Molecular Weight	70~90 kDa
GenBank Accession Number	BC069624
Gene Symbol	WBSCR17
Gene ID (NCBI)	64409
RRID	AB_10732815
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q6IS24
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

WBSCR17, also known as GALNT17, which encodes a brain-expressed N-acetylgalactosaminyl transferase (GalNAcT), is located at the distal edge of a region that is commonly deleted or duplicated in Williams Beuren Syndrome (WBS), a developmental disorder with motor and coordination problems, impaired visuospatial memory, and abnormal social interaction (PMID: 31554716). WBSCR17 loss-of-function has significant effects on cerebellar development, and is associated with phenotypes including developmental delay, deficits in motor coordination, reduced exploratory activity, and impaired social behavior (PMID: 22787146). With the calculated molecular mass of recombinant WBSCR17 being 68 kDa, the 70-90-kDa glycoproteins could also be detected due to post-translational modifications (PMID: 22787146).