Tested Applications
Positive WB detected in | HeLa cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 2 publications below |
Product Information
25164-1-AP targets WDR20 in WB, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag18353 Product name: Recombinant human WDR20 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-88 aa of BC030654 Sequence: MATEGGGKEMNEIKTQFTTREGLYKLLPHSEYSRPNRVPFNSQGSNPVRVSFVNLNDQSGNGDRLCFNVGRELYFYIYKGVRKAADLS Predict reactive species |
Full Name | WD repeat domain 20 |
Calculated Molecular Weight | 569 aa, 63 kDa |
Observed Molecular Weight | 63 kDa |
GenBank Accession Number | BC030654 |
Gene Symbol | WDR20 |
Gene ID (NCBI) | 91833 |
RRID | AB_2879934 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q8TBZ3 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for WDR20 antibody 25164-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Artif Cells Nanomed Biotechnol CircCDYL inhibits the expression of C-MYC to suppress cell growth and migration in bladder cancer. |