Tested Applications
Positive WB detected in | HEK-293 cells, Jurkat cells |
Positive IHC detected in | human lung cancer tissue, human thyroid cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:200-1:1000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
20478-1-AP targets WDR40A in WB, IHC, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag14349 Product name: Recombinant human WDR40A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-56 aa of BC008893 Sequence: LHKRKRLPPVKRSLVYYLKNREVRLQNETSYSRVLHGYAAQQLPSLLKEREFHLGT Predict reactive species |
Full Name | WD repeat domain 40A |
Calculated Molecular Weight | 453 aa, 51 kDa |
Observed Molecular Weight | 50 kDa |
GenBank Accession Number | BC008893 |
Gene Symbol | WDR40A |
Gene ID (NCBI) | 25853 |
RRID | AB_2878692 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q5T6F0 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
WDR40A, also known as DCAF12, is a 51 kDa protein. It may function as a substrate receptor for CUL4-DDB1 E3 ubiquitin-protein ligase complex(PMID: 16949367). This antibody specifically recognises the 51 kDa protein.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for WDR40A antibody 20478-1-AP | Download protocol |
IHC protocol for WDR40A antibody 20478-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |