• Featured Product
  • KD/KO Validated

XAB2 Polyclonal antibody

XAB2 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 10637-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Pre-mRNA-splicing factor SYF1, PP3898, NTC90, KIAA1177, HCRN

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, HepG2 cells, K-562 cells, Y79 cells
Positive IP detected inK-562 cells
Positive IHC detected inrat salivary gland tissue, mouse salivary gland tissue, mouse testis tissue, rat testis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inU2OS cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10637-1-AP targets XAB2 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0999

Product name: Recombinant human XAB2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 530-855 aa of BC007208

Sequence: EHKYFEESFKAYERGISLFKWPNVSDIWSTYLTKFIARYGGRKLERARDLFEQALDGCPPKYAKTLYLLYAQLEEEWGLARHAMAVYERATRAVEPAQQYDMFNIYIKRAAEIYGVTHTRGIYQKAIEVLSDEHAREMCLRFADMECKLGEIDRARAIYSFCSQICDPRTTGAFWQTWKDFEVRHGNEDTIKEMLRIRRSVQATYNTQVNFMASQMLKVSGSATGTVSDLAPGQSGMDDMKLLEQRAEQLAAEAERDQPLRAQSKILFVRSDASREELAELAQQVNPEEIQLGEDEDEDEMDLEPNEVRLEQQSVPAAVFGSLKED

Predict reactive species
Full Name XPA binding protein 2
Calculated Molecular Weight 100 kDa
Observed Molecular Weight 100 kDa
GenBank Accession NumberBC007208
Gene Symbol XAB2
Gene ID (NCBI) 56949
RRIDAB_2257336
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9HCS7
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

XPA-binding protein 2 (XAB2) a tetratricopeptide repeat protein involved in transcription-coupled DNA repair and transcription. XAB2 is involved in pre-mRNA splicing, transcription, and transcription-coupled DNA repair, leading to preimplantation lethality, and is essential for mouse embryogenesis. It interactes with Cockayne syndrome groups A and B (CSA and CSB) proteins and RNA polymerase II, which are known to be involved in transcription-coupled repair (TCR) and transcription, and that the antibodies against XAB2 protein inhibited the recovery of RNA synthesis after UV irradiation and normal RNA synthesis when microinjected into living fibroblasts.

Protocols

Product Specific Protocols
WB protocol for XAB2 antibody 10637-1-APDownload protocol
IHC protocol for XAB2 antibody 10637-1-APDownload protocol
IF protocol for XAB2 antibody 10637-1-APDownload protocol
IP protocol for XAB2 antibody 10637-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Nucleic Acids Res

XAB2 depletion induces intron retention in POLR2A to impair global transcription and promote cellular senescence.

Authors - Shuai Hou
  • KD Validated
humanWB

Nucleic Acids Res

Evidence that a consensus element found in naturally intronless mRNAs promotes mRNA export.

Authors - Lei Haixin H
  • KD Validated
humanWB,IF

Cell Death Dis

XAB2 functions in mitotic cell cycle progression via transcriptional regulation of CENPE.

Authors - Shuai Hou
  • KD Validated

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Aleksandr (Verified Customer) (07-19-2025)

Antibody recognizes a specific band of Xab2 in human RKO cells

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:2500
  • Cell Tissue Type: RKO
XAB2 Antibody Western Blot validation (1:2500 dilution) in RKO (Cat no:10637-1-AP)
FH

Moritz (Verified Customer) (08-19-2024)

Antibody worked well for WB, showing a band at ~ 100kDa using HEK293T WT cell lysate, a dilution of 1:3000 and 1h incubation time at RT.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:3000
  • Cell Tissue Type: HEK293T WT lysate
FH

Tsimafei (Verified Customer) (08-12-2024)

Antibody detect a strong band ~ 100 kDa

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:3000
  • Cell Tissue Type: mESCs
XAB2 Antibody Western Blot validation (1:3000 dilution) in mESCs (Cat no:10637-1-AP)
Loading...
||
New chat Able
正在加载,请稍候...