Tested Applications
Positive WB detected in | mouse pancreas tissue, MCF-7 cells |
Positive IHC detected in | human pancreas cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:400 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
12830-1-AP targets XK in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag3550 Product name: Recombinant human XK protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 371-444 aa of BC036019 Sequence: QFFHPCKKLFSSSVSEGFQRWLRCFCWACRQQKPCEPIGKEDLQSSRDRDETPSSSKTSPEPGQFLNAEDLCSA Predict reactive species |
Full Name | X-linked Kx blood group (McLeod syndrome) |
Calculated Molecular Weight | 444 aa, 51 kDa |
Observed Molecular Weight | 45-51 kDa |
GenBank Accession Number | BC036019 |
Gene Symbol | XK |
Gene ID (NCBI) | 7504 |
RRID | AB_2877887 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P51811 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
XK, also named as XKR1 and XRG1, is responsible for the Kx blood group system. XK forms a functional complex with the Kell glycoprotein. It represents a crucial factor for the maintenance of normal muscle structure and function.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for XK antibody 12830-1-AP | Download protocol |
IHC protocol for XK antibody 12830-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |