Tested Applications
| Positive WB detected in | human placenta tissue |
| Positive IHC detected in | human placenta tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
27049-1-AP targets XKRX in WB, IHC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25266 Product name: Recombinant human XKRX protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 101-210 aa of BC137010 Sequence: VHRDLAKDKPLSLFMHLILLGPVIRCLEAMIKYLTLWKKEEQEEPYVSLTRKKMLIDGEEVLIEWEVGHSIRTLAMHRNAYKRMSQIQAFLGSVPQLTYQLYVSLISAEV Predict reactive species |
| Full Name | XK, Kell blood group complex subunit-related, X-linked |
| Calculated Molecular Weight | 462 aa, 54 kDa |
| Observed Molecular Weight | 30 kDa |
| GenBank Accession Number | BC137010 |
| Gene Symbol | XKRX |
| Gene ID (NCBI) | 402415 |
| RRID | AB_2880732 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q6PP77 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
XKRX (XK-associated X-linked protein) is a component of the XK/Kell complex in the Kell blood group system, encoding a membrane protein with multiple transmembrane domains that is exposed on the cell surface and may function as a membrane transport protein. It is expressed predominantly in the placenta and syncytiotrophoblasts. It has 2 isoforms, with molecular weights of 52 kDa and 28 kDa respectively. Its function has not been fully clarified yet.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for XKRX antibody 27049-1-AP | Download protocol |
| WB protocol for XKRX antibody 27049-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |





