• Featured Product
  • KD/KO Validated

YBX1 Polyclonal antibody

YBX1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 20339-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, IP, CoIP, ChIP, RIP, ELISA

CBF A, CBF-A, CCAAT-binding transcription factor I subunit A, DBPB, DNA-binding protein B

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293 cells, HeLa cells, Jurkat cells, MCF-7 cells, MDA-MB-231 cells, NIH/3T3 cells
Positive IHC detected inhuman renal cell carcinoma tissue, human placenta tissue, human breast cancer tissue, human prostate cancer tissue, human tonsillitis tissue, mouse colon tissue, rat colon tissue, human colon cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

20339-1-AP targets YBX1 in WB, IHC, IF/ICC, IP, CoIP, ChIP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, pig
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag14129

Product name: Recombinant human YBX1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 134-303 aa of BC010430

Sequence: QGSKYAADRNHYRRYPRRRGPPRNYQQNYQNSESGEKNEGSESAPEGQAQQRRPYRRRRFPPYYMRRPYGRRPQYSNPPVQGEVMEGADNQGAGEQGRPVRQNMYRGYRPRFRRGPPRQRQPREDGNEEDKENQGDETQGQQPPQRRYRRNFNYRRRRPENPKPQDGKET

Predict reactive species
Full Name Y box binding protein 1
Calculated Molecular Weight 324 aa, 36 kDa
Observed Molecular Weight 36-56 kDa
GenBank Accession NumberBC010430
Gene Symbol YBX1
Gene ID (NCBI) 4904
RRIDAB_10665424
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP67809
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Y box binding protein 1(YBX1) is one of cis-acting elements which has a role in regulation of the expression of HLA class II genes. YBX1 is great of importance in regulation of PTP1B expression. It can bind to splice sites mediate pre-mRNA alternative splicing regulation. Also, it involves the regulation of translation by modulation of the interaction between the mRNA and eukaryotic initiation factors. Its transcriptional activity on the multidrug resistance gene MDR1 is enhanced in presence of the APEX1 acetylated form at 'Lys-6' and 'Lys-7'. The secreted form acts as an extracellular mitogen and stimulates cell migration and proliferation. The calculated molecular weight of YBX1 is 36 kDa, but modified YBX1 is about 36-56 kDa (PMID: 27384875 ). Recently, researchers developed a biomimetic nanoplatform to deliver RNA piR-RCC specifically into RCC tumors. This RNA interacts with YBX1 to inhibit tumor proliferation and metastasis (PMID: 40411401).

Protocols

Product Specific Protocols
WB protocol for YBX1 antibody 20339-1-APDownload protocol
IHC protocol for YBX1 antibody 20339-1-APDownload protocol
IF protocol for YBX1 antibody 20339-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Nature

Systematic quantitative analysis of ribosome inventory during nutrient stress.

Authors - Heeseon An
mouseIF

Sci Adv

Profiling and functional characterization of maternal mRNA translation during mouse maternal-to-zygotic transition.

Authors - Chunxia Zhang
humanWB

Nat Commun

Targeting USP47 overcomes tyrosine kinase inhibitor resistance and eradicates leukemia stem/progenitor cells in chronic myelogenous leukemia.

Authors - Hu Lei
  • KD Validated
humanChIP

Cell Death Differ

YB-1 is a positive regulator of KLF5 transcription factor in basal-like breast cancer.

Authors - Dewei Jiang
  • KD Validated
humanWB,IF

Cell Rep

Coordinated post-transcriptional control of oncogene-induced senescence by UNR/CSDE1.

Authors - Rosario Avolio
  • KD Validated
humanWB

Nucleic Acids Res

YB-1 regulates tiRNA-induced Stress Granule formation but not translational repression.

Authors - Shawn M Lyons
  • KD Validated

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Tatyana (Verified Customer) (03-11-2023)

Detects protein recruited to sodium arsenite induced stress granules (see image). 4% PFA fixation followed by methanol permeabilization; antibody prepared in 5% goat serum in PBST; 2 h at RT incubation.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Human / SH-SY5Y cells
YBX1 Antibody Immunofluorescence validation (1:1000 dilution) in Human / SH-SY5Y cells (Cat no:20339-1-AP)
FH

Sun (Verified Customer) (01-05-2023)

a good antibody. YBX1 is a quite abundant protein and this antibody detects it pretty well.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:2000
  • Cell Tissue Type: HEK293T
FH

Meliti (Verified Customer) (08-05-2020)

Not vey clean in terms of the background but gives a nice band corresponding to YBX1

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:3000
  • Cell Tissue Type: HEK293
YBX1 Antibody Western Blot validation (1:3000 dilution) in HEK293 (Cat no:20339-1-AP)
FH

H (Verified Customer) (04-06-2020)

This antibody works well in my hands using HEK293T cell lysates. I used LICOR anti-rabbit IRDye800 secondary antibody coupled with Odyssey Clx detection.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: HEK293T
YBX1 Antibody Western Blot validation (1:1000 dilution) in HEK293T (Cat no:20339-1-AP)
Loading...
||
New chat Able
正在加载,请稍候...