Tested Applications
Positive WB detected in | human brain tissue, human liver tissue, human testis tissue |
Positive IHC detected in | human brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 1 publications below |
WB | See 1 publications below |
Product Information
17743-1-AP targets YPEL1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag11993 Product name: Recombinant human YPEL1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-119 aa of BC074501 Sequence: MVKMTKSKTFQAYLPNCHRTYSCIHCRAHLANHDELISKSFQGSQGRAYLFNSVVNVGCGPAEERVLLTGLHAVADIYCENCKTTLGWKYEHAFESSQKYKEGKFIIDLAHMIKDNGWE Predict reactive species |
Full Name | yippee-like 1 (Drosophila) |
Calculated Molecular Weight | 119 aa, 14 kDa |
Observed Molecular Weight | 20-23 kDa |
GenBank Accession Number | BC074501 |
Gene Symbol | YPEL1 |
Gene ID (NCBI) | 29799 |
RRID | AB_2217464 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | O60688 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for YPEL1 antibody 17743-1-AP | Download protocol |
IHC protocol for YPEL1 antibody 17743-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |