Tested Applications
| Positive WB detected in | human brain tissue, human liver tissue, human testis tissue |
| Positive IHC detected in | human brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
17743-1-AP targets YPEL1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag11993 Product name: Recombinant human YPEL1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-119 aa of BC074501 Sequence: MVKMTKSKTFQAYLPNCHRTYSCIHCRAHLANHDELISKSFQGSQGRAYLFNSVVNVGCGPAEERVLLTGLHAVADIYCENCKTTLGWKYEHAFESSQKYKEGKFIIDLAHMIKDNGWE Predict reactive species |
| Full Name | yippee-like 1 (Drosophila) |
| Calculated Molecular Weight | 119 aa, 14 kDa |
| Observed Molecular Weight | 20-23 kDa |
| GenBank Accession Number | BC074501 |
| Gene Symbol | YPEL1 |
| Gene ID (NCBI) | 29799 |
| RRID | AB_2217464 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O60688 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for YPEL1 antibody 17743-1-AP | Download protocol |
| WB protocol for YPEL1 antibody 17743-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
| Species | Application | Title |
|---|---|---|
Oncol Rep Comprehensive analysis of the expression and prognosis of YPEL family members in clear cell renal cell cancer.
| ||
Biochem Biophys Res Commun Development of a vitamin-related gene signature to predict the immune characteristics and prognosis of glioma. |









