Tested Applications
| Positive WB detected in | HEK-293 cells, Jurkat cells, HeLa cells, MOLT-4 cells, NIH/3T3 cells, C6 cells, Raji cells |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse brain tissue |
| Positive IF/ICC detected in | U2OS cells, HeLa cells, sodium arsenite treated HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:12000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
24744-1-AP targets YTHDF2 in WB, IHC, IF/ICC, IF-P, IP, CoIP, chIP, RIP, ELISA, CLIP applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, monkey, chicken, zebrafish, hamster, sheep, goat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag5922 Product name: Recombinant human YTHDF2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 339-565 aa of BC002559 Sequence: LSVQQQAAQPTRWVAPRNRGSGFGHNGVDGNGVGQSQAGSGSTPSEPHPVLEKLRSINNYNPKDFDWNLKHGRVFIIKSYSEDDIHRSIKYNIWCSTEHGNKRLDAAYRSMNGKGPVYLLFSVNGSGHFCGVAEMKSAVDYNTCAGVWSQDKWKGRFDVRWIFVKDVPNSQLRHIRLENNENKPVTNSRDTQEVPLEKAKQVLKIIASYKHTTSIFDDFSHYEKRQE Predict reactive species |
| Full Name | YTH domain family, member 2 |
| Calculated Molecular Weight | 62 kDa |
| Observed Molecular Weight | 62 kDa |
| GenBank Accession Number | BC002559 |
| Gene Symbol | YTHDF2 |
| Gene ID (NCBI) | 51441 |
| RRID | AB_2687435 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9Y5A9 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
YTHDF2 also named as CLL associated antigen KW 14 or HGRG8 is a 579 amino acid protein, which contains one YTH domain and exists as two alternatively spliced isoforms. YTHDF2 is expressed in in pancreas, testis and placenta. YTHDF2 may play a role in human longevity. Due to the high sequence similarity, 24744-1-AP is likely to cross-react with both YTHDF1 and YTHDF3.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for YTHDF2 antibody 24744-1-AP | Download protocol |
| IHC protocol for YTHDF2 antibody 24744-1-AP | Download protocol |
| IP protocol for YTHDF2 antibody 24744-1-AP | Download protocol |
| WB protocol for YTHDF2 antibody 24744-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
Catalog No. 24744-1-AP, a YTHDF2 antibody, has accumulated 460 total citations. Publications appear in high-impact journals including Nature, Science, Cell, Nature Communications, Molecular Cell, Cancer Research, Nucleic Acids Research, Cell Death & Disease, and Theranostics. Key research fields encompass m6A RNA methylation/epitranscriptomics, oncology (glioblastoma, breast, lung, colorectal, liver cancers), neuroscience, immunology, metabolism, virology, developmental biology, ferroptosis, and phase separation.
| Species | Application | Title |
|---|---|---|
Nature Dynamic m(6)A mRNA methylation directs translational control of heat shock response. | ||
Nature Anti-tumour immunity controlled through mRNA m6A methylation and YTHDF1 in dendritic cells. | ||
Nat Med Stem cell architecture drives myelodysplastic syndrome progression and predicts response to venetoclax-based therapy. |
Reviews
What customers say
All four reviews are five-star. Users report strong performance across Western Blot, IHC, immunofluorescence, and ChIP. One reviewer highlighted clear cytoplasmic stress granule staining in ICC (HeLa/SH-SY5Y) and specific signal in mouse spinal cord tissue. Another confirmed reliable WB results at 1:3000 dilution. A porcine cell study using YTHDF2 siRNA knockdown also showed effective detection. Overall, customers consistently describe the antibody as working well with good visibility and specificity at dilutions of 1:1000–1:3000.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Mounika (Verified Customer) (12-25-2025) | Antibodies are excellent, we bought 2 vials, we are using it, visibility is good.
|
Tatyana (Verified Customer) (12-22-2024) | Works well in WB, ICC and IHC. ICC with antibody diluted in 5% goat serum in PBST, with 2 h incubation at RT. Cytoplasmic staining, recognises stress granules. WB with antibody diluted in 4% milk in TBST, with ON incubation. Also gives what looks like specific staining in mouse spinal cord (DAB and fluorescence).
 |
Jinyun (Verified Customer) (08-26-2022) | I did the western blot, and the antibody worked quite well.
|
Robert (Verified Customer) (01-24-2019) | 1. scrambled siRNA2. YTHDF2 siRNA
 |
