Tested Applications
| Positive IHC detected in | human colon cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| ELISA | See 1 publications below |
Product Information
10936-1-AP targets YWHAB in IHC, IF/ICC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1383 Product name: Recombinant human YWHAB protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-63 aa of BC010352 Sequence: MNDLICFLDNTFKNNVLSQAWWCVHLVPTIWEAEAGGSLEPRSLKLQCPVVAPVNNCTPAWAT Predict reactive species |
| Full Name | tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide |
| Calculated Molecular Weight | 28 kDa |
| GenBank Accession Number | BC010352 |
| Gene Symbol | YWHAB |
| Gene ID (NCBI) | 7529 |
| RRID | AB_2217489 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P31946 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
YWHAB (also known as 14-3-3 beta) is a member of 14-3-3 proteins which were the first phosphoserine/phosphothreonine-binding proteins to be discovered. 14-3-3 family members interact with a wide spectrum of proteins and possess diverse functions. Mammals express seven distinct 14-3-3 isoforms (gamma, epsilon, beta, zeta, sigma, theta, tau) that form multiple homo- and hetero- dimmers. 14-3-3 proteins display the highest expression levels in the brain, and have been implicated in several neurodegenerative diseases, including Alzheimer's disease and amyotrophic lateral sclerosis. This antibody was raised agaist the N-terminal region of human YWHAB.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for YWHAB antibody 10936-1-AP | Download protocol |
| IHC protocol for YWHAB antibody 10936-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |









