Tested Applications
Positive IHC detected in | human colon cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
Application | Dilution |
---|---|
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
ELISA | See 1 publications below |
Product Information
10936-1-AP targets YWHAB in IHC, IF/ICC, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Cited Reactivity | mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag1383 Product name: Recombinant human YWHAB protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-63 aa of BC010352 Sequence: MNDLICFLDNTFKNNVLSQAWWCVHLVPTIWEAEAGGSLEPRSLKLQCPVVAPVNNCTPAWAT Predict reactive species |
Full Name | tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide |
Calculated Molecular Weight | 28 kDa |
GenBank Accession Number | BC010352 |
Gene Symbol | YWHAB |
Gene ID (NCBI) | 7529 |
RRID | AB_2217489 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P31946 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
YWHAB (also known as 14-3-3 beta) is a member of 14-3-3 proteins which were the first phosphoserine/phosphothreonine-binding proteins to be discovered. 14-3-3 family members interact with a wide spectrum of proteins and possess diverse functions. Mammals express seven distinct 14-3-3 isoforms (gamma, epsilon, beta, zeta, sigma, theta, tau) that form multiple homo- and hetero- dimmers. 14-3-3 proteins display the highest expression levels in the brain, and have been implicated in several neurodegenerative diseases, including Alzheimer's disease and amyotrophic lateral sclerosis. This antibody was raised agaist the N-terminal region of human YWHAB.
Protocols
Product Specific Protocols | |
---|---|
IHC protocol for YWHAB antibody 10936-1-AP | Download protocol |
IF protocol for YWHAB antibody 10936-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |