• Featured Product
  • KD/KO Validated

ZBP1 Polyclonal antibody

ZBP1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 13285-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF/ICC, ELISA

C20orf183, DAI, DLM 1, DLM1, Tumor stroma and activated macrophage protein DLM-1

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, HepG2 cells, Jurkat cells
Positive IHC detected inhuman liver cancer tissue, human colon cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:8000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:400-1:1600
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

13285-1-AP targets ZBP1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag4119

Product name: Recombinant human ZBP1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-149 aa of BC028218

Sequence: MAQAPADPGREGHLEQRILQVLTEAGSPVKLAQLVKECQAPKRELNQVLYRMKKELKVSLTSPATWCLGGTDPEGEGPAELALSSPGNCHPGEAGLTLQGASWQWTSTDLSLGSNLNSATWELTGFLSLCLGFFFWLMELTAGLLGRGC

Predict reactive species
Full Name Z-DNA binding protein 1
Calculated Molecular Weight 46 kDa
Observed Molecular Weight 42-68 kDa
GenBank Accession NumberBC028218
Gene Symbol ZBP1
Gene ID (NCBI) 81030
RRIDAB_2122651
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9H171
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ZBP1(Z-DNA-binding protein 1), also named as DAI or DLM-1, is a nucleic acid sensor with some isoforms. It has been reported that ZBP1 can sense the viral nucleic acids of viruses and induce the death of infected cells to prevent virus transmission. ZBP1 can be activated and causes necrocytosis without viral infection, which is associated with nuclear Z-form nucleic acids. ZBP1 can be detected 42 kDa, 55 kDa, 68 kDa isoforms (PMID: 37012234, PMID: 9121465).

Protocols

Product Specific Protocols
WB protocol for ZBP1 antibody 13285-1-APDownload protocol
IHC protocol for ZBP1 antibody 13285-1-APDownload protocol
IF protocol for ZBP1 antibody 13285-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

J Med Virol

SARS-CoV-2 infection of polarized human airway epithelium induces necroptosis that causes airway epithelial barrier dysfunction

Authors - Siyuan Hao
humanWB

Cell Death Dis

Sensing of endogenous retroviruses-derived RNA by ZBP1 triggers PANoptosis in DNA damage and contributes to toxic side effects of chemotherapy

Authors - Fang Wang
humanIHC

Cell Death Dis

ZBP1-mediated PANoptosis is a crucial lethal form in diverse keratinocyte death modalities in UVB-induced skin injury

Authors - Xuechan Bi
rat,humanWB

Biochim Biophys Acta Mol Basis Dis

Ischemia-reperfusion injury induces ZBP1-dependent PANoptosis in endothelial cells

Authors - Yue Cui
humanWB

J Agric Food Chem

Integrative Gut Microbiota and Metabolomic Analyses Reveal the PANoptosis- and Ferroptosis-Related Mechanisms of Chrysoeriol in Inhibiting Melanoma

Authors - Yuxi Liu
humanWB

Sci Rep

Mitochondrial DNA damage and subsequent activation of Z-DNA binding protein 1 links oxidative stress to inflammation in epithelial cells.

Authors - Bartosz Szczesny
  • KD Validated

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Charity (Verified Customer) (02-15-2024)

this will probably work at a lower concentration but I have not tried it yet.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: mouse lung tissue sections
ZBP1 Antibody Immunofluorescence validation (1:100 dilution) in mouse lung tissue sections (Cat no:13285-1-AP)
Loading...