Tested Applications
Positive WB detected in | PC-3 cells, MCF-7 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
25985-1-AP targets ZDHHC7 in WB, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag23185 Product name: Recombinant human ZDHHC7 protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 279-345 aa of BC018772 Sequence: IHSICNDETEIERLKSEKPTWERRLRWEGMKSVFGGPPSLLWMNPFVGFRFRRLPTRPRKGGPEFSV Predict reactive species |
Full Name | zinc finger, DHHC-type containing 7 |
Calculated Molecular Weight | 345 aa, 39 kDa |
Observed Molecular Weight | 45-49 kDa |
GenBank Accession Number | BC018772 |
Gene Symbol | ZDHHC7 |
Gene ID (NCBI) | 55625 |
RRID | AB_2880320 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q9NXF8 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for ZDHHC7 antibody 25985-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |