Tested Applications
| Positive WB detected in | A431 cells, HeLa cells, Jurkat cells, HepG2 cells |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 5 publications below |
| IHC | See 1 publications below |
| ChIP | See 2 publications below |
Product Information
25299-1-AP targets ZNF460 in WB, IHC, IF/ICC, ChIP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag18106 Product name: Recombinant human ZNF460 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 102-211 aa of BC118625 Sequence: MQEYFLRPGTDPQSEKLHGKMSLEHEGLATADGICSMMIQNQVSPEDALYGFDSYGPVTDSLIHEGENSYKFEEMFNENCFLVQHEQILPRVKPYDCPECGKAFGKSKHL Predict reactive species |
| Full Name | zinc finger protein 460 |
| Calculated Molecular Weight | 562 aa, 64 kDa |
| Observed Molecular Weight | 65 kDa |
| GenBank Accession Number | BC118625 |
| Gene Symbol | ZNF460 |
| Gene ID (NCBI) | 10794 |
| RRID | AB_2880016 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q14592 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for ZNF460 antibody 25299-1-AP | Download protocol |
| WB protocol for ZNF460 antibody 25299-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Autophagy ATG10S promotes IFNL1 expression and autophagic degradation of multiple viral proteins mediated by IFNL1 | ||
Cell Rep Targeting CXCR1 alleviates hyperoxia-induced lung injury through promoting glutamine metabolism | ||
J Cancer Overexpression of ZNF460 predicts worse survival and promotes metastasis through JAK2/STAT3 signaling pathway in patient with colon cancer. | ||
J Cell Mol Med LncRNA SNHG14 Regulated by ZNF460 Promotes Gastric Cancer Progression and Metastasis by Targeting the miR-206/FNDC3A Axis | ||
Mol Cancer ZNF460-mediated circRPPH1 promotes TNBC progression through ITGA5-induced FAK/PI3K/AKT activation in a ceRNA manner | ||
Arch Biochem Biophys ZNF460 enhances HADHB level by activating its transcription to promote the progression and pulmonary invasion of cutaneous T cell lymphoma |





