Tested Applications
| Positive WB detected in | SH-SY5Y cells, A549 cells, HeLa cells, SMMC-7721 cells |
| Positive IF/ICC detected in | A549 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:20-1:200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
25592-1-AP targets ZNF549 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag22371 Product name: Recombinant human ZNF549 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 109-236 aa of BC060863 Sequence: CILVMKDILYLSEHQGTLPWQKPYTSVASGKWFSFGSNLQQHQNQDSGEKHIRKEESSALLLNSCKIPLSDNLFPCKDVEKDFPTILGLLQHQTTHSRQEYAHRSRETFQQRRYKCEQVFNEKVHVTE Predict reactive species |
| Full Name | zinc finger protein 549 |
| Calculated Molecular Weight | 640 aa, 74 kDa |
| Observed Molecular Weight | 74 kDa |
| GenBank Accession Number | BC060863 |
| Gene Symbol | ZNF549 |
| Gene ID (NCBI) | 256051 |
| RRID | AB_2880147 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q6P9A3 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for ZNF549 antibody 25592-1-AP | Download protocol |
| WB protocol for ZNF549 antibody 25592-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |









