Tested Applications
| Positive WB detected in | HeLa cells, HepG2 cells, mouse testis tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
25573-1-AP targets ZNF689 in WB, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag22252 Product name: Recombinant human ZNF689 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 77-173 aa of BC014000 Sequence: LISWLERNTDDWEPAALDPQEYPRGLTVQRKSRTRKKNGEKEVFPPKEAPRKGKRGRRPSKPRLIPRQTSGGPICPDCGCTFPDHQALESHKCAQNL Predict reactive species |
| Full Name | zinc finger protein 689 |
| Calculated Molecular Weight | 500 aa, 57 kDa |
| Observed Molecular Weight | 50-57 kDa |
| GenBank Accession Number | BC014000 |
| Gene Symbol | ZNF689 |
| Gene ID (NCBI) | 115509 |
| RRID | AB_2880134 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q96CS4 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
ZNF689, a C2H2-type of Krüppel-associated box (KRAB)-zinc finger protein, is a putative transcription regulating factor. ZNF689 knockdown induced expression of the pro-apoptotic factors of the Bcl-2 family, Bax, Bcl-2 antagonist/killer 1 and Bid, resulting in tumor cell apoptosis (PMID: 21624362). ZNF689 was identified to be involved in suppressing the apoptosis of HCC cells via downregulation of the expression of pro-apoptotic factors (PMID: 38168642).
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for ZNF689 antibody 25573-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |







