Tested Applications
| Positive WB detected in | HT-29 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2400 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
25556-1-AP targets ZNF695 in WB, IHC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag22202 Product name: Recombinant human ZNF695 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 88-133 aa of BC023527 Sequence: LSSYLTEDILPEQGLQVSFQKVMLRRYERCCLEKLRLRNDWEIVAM Predict reactive species |
| Full Name | zinc finger protein 695 |
| Calculated Molecular Weight | 515 aa, 60 kDa |
| Observed Molecular Weight | 43 kDa |
| GenBank Accession Number | BC023527 |
| Gene Symbol | ZNF695 |
| Gene ID (NCBI) | 57116 |
| RRID | AB_2880130 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q8IW36 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
ZNF695 is a KRAB-containing zinc finger transcription factor localized in the nucleus. It binds DNA and mediates transcriptional repression, and its dysregulation participates in tumor progression across multiple malignancies. Elevated ZNF695 promotes cancer cell proliferation, accelerates cell cycle and suppresses apoptosis by activating NEK2 and PI3K/Akt/mTOR pathways. It acts as a prognostic biomarker correlated with tumor immune infiltration in colorectal, cervical, breast and endometrial cancers. Its expression varies among tumor subtypes, associating with aggressive tumor phenotypes (PMID: 38441026; PMID: 40682845).
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for ZNF695 antibody 25556-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The ZNF695 Polyclonal antibody (Cat# 25556-1-AP) has 2 citations. One appears in Oncology Reports (2025), studying ZNF695's role in colorectal cancer cell proliferation via NEK2 and PI3K/Akt/mTOR pathways (WB). The other is in Journal of Cancer (2021), investigating a five-gene signature associated with Gleason score as biomarkers for early prostate adenocarcinoma recurrence (IHC). Research fields span colorectal cancer signaling and prostate cancer diagnostics.
| Species | Application | Title |
|---|---|---|
Oncol Rep Zinc finger protein 695 facilitates the proliferation of colorectal cancer cells through activation of the NEK2 and PI3K/Akt/mTOR signaling pathways
| ||
J Cancer Five-gene signature associating with Gleason score serve as novel biomarkers for identifying early recurring events and contributing to early diagnosis for Prostate Adenocarcinoma. |
Reviews
What customers say
One review was submitted by Claire Makowski (rated 1/5) for lot 00023334. The reviewer reported that the antibody failed to detect ZNF695 by Western Blot at a 1:300 dilution across three different cell types: hBJ fibroblasts, MCF7, and HepG2. No positive results were observed in any of the tested samples.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Claire (Verified Customer) (01-13-2026) | This antibody did not detect ZNF695 by western blot in three different cell types - hBJ fibroblasts, MCF7, and HEPG2. Please see attached files for details.
 |
