Tested Applications
Positive WB detected in | A549 cells, HeLa cells, MCF-7 cells |
Positive IHC detected in | mouse kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | A549 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:1000-1:5000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 2 publications below |
WB | See 6 publications below |
IF | See 5 publications below |
IP | See 1 publications below |
Product Information
10330-1-AP targets Zyxin in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Cited Reactivity | human, mouse, rabbit |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag0419 Product name: Recombinant human ZYX protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 278-572 aa of BC008743 Sequence: SKFSPGAPGGSGSQPNQKLGHPEALSAGTGSPQPPSFTYAQQREKPRVQEKQHPVPPPAQNQNQVRSPGAPGPLTLKEVEELEQLTQQLMQDMEHPQRQNVAVNELCGRCHQPLARAQPAVRALGQLFHIACFTCHQCAQQLQGQQFYSLEGAPYCEGCYTDTLEKCNTCGEPITDRMLRATGKAYHPHCFTCVVCARPLEGTSFIVDQANRPHCVPDYHKQYAPRCSVCSEPIMPEPGRDETVRVVALDKNFHMKCYKCEDCGKPLSIEADDNGCFPLDGHVLCRKCHTARAQT Predict reactive species |
Full Name | zyxin |
Calculated Molecular Weight | 80 kDa |
Observed Molecular Weight | 78 kDa |
GenBank Accession Number | BC008743 |
Gene Symbol | Zyxin |
Gene ID (NCBI) | 7791 |
RRID | AB_2221279 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q15942 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Focal adhesions are actin-rich structures that enable cells to adhere to the extracellular matrix and at which protein complexes involved in signal transduction assemble. Zyxin (ZYX) is a zinc-binding phosphoprotein that concentrates at focal adhesions and along the actin cytoskeleton. Zyxin has an N-terminal proline-rich domain and three LIM domains in its C-terminal half. The proline-rich domain may interact with SH3 domains of proteins involved in signal transduction pathways while the LIM domains are likely involved in protein-protein binding. Zyxin may function as a messenger in the signal transduction pathway that mediates adhesion-stimulated changes in gene expression and may modulate the cytoskeletal organization of actin bundles.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for Zyxin antibody 10330-1-AP | Download protocol |
IHC protocol for Zyxin antibody 10330-1-AP | Download protocol |
IF protocol for Zyxin antibody 10330-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
J Cell Biol The late endosomal p14-MP1 (LAMTOR2/3) complex regulates focal adhesion dynamics during cell migration. | ||
Cell Death Dis Essential role of zyxin in platelet biogenesis and glycoprotein Ib-IX surface expression
| ||
Cell Prolif Zyxin-involved actin regulation is essential in the maintenance of vinculin focal adhesion and chondrocyte differentiation status.
| ||
J Biol Chem O-GlcNAc transferase promotes the nuclear localization of the focal adhesion-associated protein Zyxin to regulate UV-induced cell death. | ||
Am J Physiol Gastrointest Liver Physiol Targeted disruption of the Lasp-1 gene is linked to increases in histamine-stimulated gastric HCl secretion. | ||
Physiol Genomics Lasp1 gene disruption is linked to enhanced cell migration and tumor formation. |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Alex (Verified Customer) (08-20-2025) | Excellent staining of adhesions and actin filament tips. Consistent with literature-reported fluorescent protein constructs. In image: A - Paxillin (from another manufacturer) B - Zyxin (10330-1-AP. 1:200) C - Phalloidin (from another manufacturer) D - Merged (G = Paxillin; R = Zyxin; gray = phalloidin)
![]() |