• KD/KO Validated

Alpha Synuclein Monoclonal antibody

Alpha Synuclein Monoclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 66412-1-Ig
Clone No.1B10E9

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, ELISA

1, a-synuclein, SNCA, 1B10E9, alpha syn

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse brain tissue, rat brain tissue
Positive IHC detected inmouse cerebellum tissue, human brain tissue, mouse brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse cerebellum tissue
Positive FC (Intra) detected inSH-SY5Y cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)-PIF-P : 1:200-1:800
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66412-1-Ig targets Alpha Synuclein in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, rat
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag1285

Product name: Recombinant human a-Synuclein protein

Source: e coli.-derived, PKG

Tag: GST

Domain: 1-140 aa of BC013293

Sequence: MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA

Predict reactive species
Full Name synuclein, alpha (non A4 component of amyloid precursor)
Calculated Molecular Weight 14 kDa
Observed Molecular Weight 18-19 kDa
GenBank Accession NumberBC013293
Gene Symbol Alpha Synuclein
Gene ID (NCBI) 6622
RRIDAB_2881784
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP37840
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Alpha Synuclein (α-syn) is a 14-19 kDa phosphoprotein that is primarily localize to the presynaptic terminals of mature neurons, where it is involved in synaptic function and plasticity. α-syn has drawn intense interest ever since the late 1990s, when the first α-synuclein missense mutation was identified as a cause of familial Parkinson's disease (PD). Aggregated and hyper-phosphorylated forms of α-syn protein are the pathological hallmark of Lewy body disease, which includes Parkinson's disease (PD), diffuse Lewy body disease (DLBD), and Lewy body variant of Alzheimer's disease (LBV). This antibody can recognize all the isoforms of α-syn.

Protocols

Product Specific Protocols
FC protocol for Alpha Synuclein antibody 66412-1-IgDownload protocol
IF protocol for Alpha Synuclein antibody 66412-1-IgDownload protocol
IHC protocol for Alpha Synuclein antibody 66412-1-IgDownload protocol
WB protocol for Alpha Synuclein antibody 66412-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIF

Appl Microbiol Biotechnol

The alteration of intestinal mucosal α-synuclein expression and mucosal microbiota in Parkinson's disease

Authors - Jihua Shi
ratIHC

Biomed Pharmacother

Nardosinone regulates the slc38a2 gene to alleviate Parkinson's symptoms in rats through the GABAergic synaptic and cAMP pathways.

Authors - Li-Hua Bian
ratIHC

J Neuropathol Exp Neurol

Regular Aerobic Exercise-Alleviated Dysregulation of CAMKIIα Carbonylation to Mitigate Parkinsonism via Homeostasis of Apoptosis With Autophagy.

Authors - Wenfeng Liu
WB,IHC,IF

Biochem Biophys Res Commun

Systematic identification of SNCA as a key gene in ischemic cardiomyopathy via integrated weighted gene co-expression network analysis and experimental validation

Authors - Yaoxi Zhu
  • KD Validated

NPJ Parkinsons Dis

Urea cycle dysregulation drives metabolic stress and neurodegeneration in Parkinson's disease

Authors - Shengyao Zhang
humanIF

Nat Commun

DNA nanoflower Oligo-PROTAC for targeted degradation of FUS to treat neurodegenerative diseases

Authors - Ruixin Ge

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Boyan (Verified Customer) (01-13-2026)

very weak band around the expected molecular weight

  • Applications: Western Blot
  • Cell Tissue Type: human
FH

Janelle (Verified Customer) (09-12-2022)

Perfect for WB!

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
FH

BISHR (Verified Customer) (05-10-2022)

I used it in WB with 1:1000 ration, the band was clear and almost perfect. However, it says the expected kd ranges from 14 to 18, unfortunately I am getting far higher bands up to 50 kd sometimes. Although I am using concentrated acrylamide in the gel, it is making it difficult for reviewers to understand that.

  • Applications: Western Blot, Immunofluorescence
  • Cell Tissue Type: SH-SY5Y
Alpha Synuclein Antibody Western Blot,Immunofluorescence validation ( dilution) in SH-SY5Y (Cat no:66412-1-Ig)
FH

q (Verified Customer) (01-05-2022)

It is good in WB with a specific band at 17 kd around.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:3000
  • Cell Tissue Type: mouse brain lysate
Alpha Synuclein Antibody Western Blot validation (1:3000 dilution) in mouse brain lysate (Cat no:66412-1-Ig)
FH

Sheela (Verified Customer) (07-16-2019)

This product worked as expected

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Mouse brain lysate
Alpha Synuclein Antibody Western Blot, validation (1:1000 dilution) in Mouse brain lysate (Cat no:66412-1-Ig)
Loading...
||
New chat

Able

正在加载,请稍候...