Tested Applications
| Positive WB detected in | JAR cells, human placenta tissue, SK-BR-3 cells |
| Positive IHC detected in | human placenta tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
25014-1-AP targets hCG Alpha in WB, IHC, IF, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag17313 Product name: Recombinant human CGA protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 24-116 aa of BC020782 Sequence: SAPDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS Predict reactive species |
| Full Name | glycoprotein hormones, alpha polypeptide |
| Calculated Molecular Weight | 116 aa, 13 kDa |
| Observed Molecular Weight | 22 kDa |
| GenBank Accession Number | BC020782 |
| Gene Symbol | hCG Alpha |
| Gene ID (NCBI) | 1081 |
| RRID | AB_2879846 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P01215 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Human chorionic gonadotropin (hCG) is a heterodimeric glycoprotein hormone consisting of two non-covalently linked subunits: a common α-subunit (hCGα) and a hormone-specific β-subunit (hCGβ) . The α-subunit, also designated CGA (chorionic gonadotropin alpha chain), is a 92-amino-acid glycopeptide of ~14-22 kDa that is identical to the α-subunits of the pituitary glycoprotein hormones luteinizing hormone (LH), follicle-stimulating hormone (FSH), and thyroid-stimulating hormone (TSH). Because the α-subunit is shared among these hormones, its biological specificity is conferred by the unique β-subunit with which it associates.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for hCG Alpha antibody 25014-1-AP | Download protocol |
| WB protocol for hCG Alpha antibody 25014-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
| Species | Application | Title |
|---|---|---|
J Clin Endocrinol Metab A Patient with a Thyrotropin-secreting Microadenoma and Resistance to Thyroid Hormone (P453T). | ||
Eur J Pharm Sci Transplacental transfer of metformin and interaction of metformin with the uptake transporters of placental trophoblast cells | ||
iScience L3MBTL2-mediated CGA transcriptional suppression promotes pancreatic cancer progression through modulating autophagy. | ||
Cancer Res ARID1A Stimulates Notch-TLL1 Signaling to Induce Cancer-Associated Fibroblast Activation and Intrahepatic Cholangiocarcinoma Development | ||
J Biol Chem miR-107 reverses the multidrug resistance of gastric cancer by targeting the CGA/EGFR/GATA2 positive feedback circuit |









