Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

p38 MAPK Monoclonal antibody

p38 MAPK Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 66234-1-Ig
Clone No.1A1C2

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF/ICC, CoIP, ELISA

MAPK14, 1A1C2, CSAID-binding protein, CSBP, CSBP1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, Jurkat cells, HEK-293 cells, pig heart tissue, human heart tissue, K-562 cells, HSC-T6 cells, RAW 264.7 cells, MCF-7 cells
Positive IHC detected inhuman lung cancer tissue, human gliomas tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:6000
Immunohistochemistry (IHC)IHC : 1:250-1:1000
Immunofluorescence (IF)/ICCIF/ICC : 1:1000-1:4000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66234-1-Ig targets p38 MAPK in WB, IHC, IF/ICC, CoIP, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Cited Reactivityhuman, mouse, rat, pig
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag5797

Product name: Recombinant human p38 MAPK protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-307 aa of BC031574

Sequence: MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAY

Predict reactive species
Full Name mitogen-activated protein kinase 14
Calculated Molecular Weight 360 aa, 41 kDa
Observed Molecular Weight 38-42 kDa
GenBank Accession NumberBC031574
Gene Symbol p38 MAPK
Gene ID (NCBI) 1432
RRIDAB_2861335
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ16539
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MAPK14(mitogen-activated protein kinase 14) is also named as SAPK2A, p38MAPK, CSBP1, RK, p38, EXIP, Mxi2, CSBP2, PRKM14, PRKM15, CSPB1, p38ALPHA and belongs to the MAP kinase subfamily. MAPK14-signaling is a central pathway for the integration of instructive signals in dendritic cells for T(H)17 differentiation and inflammation(PMID:22231518). It plays an important role in the regulation of hematopoietic stem cell self-renewal in vitro and inhibition of MAPK14 activation with a small molecule inhibitor may represent a novel approach to promote ex vivo expansion of hematopoietic stem cell(PMID:21198398). This protein has 4 isoforms produced by alternative splicing.

Protocols

Product Specific Protocols
IF protocol for p38 MAPK antibody 66234-1-IgDownload protocol
IHC protocol for p38 MAPK antibody 66234-1-IgDownload protocol
WB protocol for p38 MAPK antibody 66234-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
ratWB

J Hazard Mater

ERK/p38/ROS burst responses to environmentally relevant concentrations of diphenyl phosphate-evoked neutrophil extracellular traps formation: Assessing the role of autophagy.

Authors - Siwen Li
mouseWB

Free Radic Biol Med

Cathelicidin-WA attenuates LPS-induced inflammation and redox imbalance through activation of AMPK signaling.

Authors - Weiche Wu
humanWB

J Invest Dermatol

GRP78 Downregulation in Keratinocytes Promotes Skin Inflammation Via the Recruitment and Activation of CCR6+ IL-17A-producing γδ T Cells

Authors - Liang Zhao
humanWB

Pharmacol Res

Anti-thrombotic effects mediated by dihydromyricetin involve both platelet inhibition and endothelial protection.

Authors - Shuai Chen
humanWB

Pharmacol Res

CX-5461 is a potent immunosuppressant which inhibits T cell-mediated alloimmunity via p53-DUSP5.

Authors - Guopin Pan
WB

Development

FOXO1 mediates hypoxia-induced G0/G1 arrest in ovarian somatic granulosa cells by activating the TP53INP1-p53-CDKN1A pathway.

Authors - Chengyu Li

Reviews

    1.0 out of 5
Add a review

1 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Karen (Verified Customer) (11-10-2022)

p38MAPK detection for WB is not good, no bands detectable with different dilutions (1:500 and 1:1000). The same membrane was incubated with another p38MAPK antibody and was nicely visible.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000 and 1:500
  • Cell Tissue Type: HaCaTs
p38 MAPK Antibody Western Blot validation (1:1000 and 1:500 dilution) in HaCaTs (Cat no:66234-1-Ig)
Loading...
||
New chat

Able

正在加载,请稍候...