Tested Applications
| Positive WB detected in | mouse brain tissue, HeLa cells |
| Positive IHC detected in | human skin cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | C2C12 cells, MDCK cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:250-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
26195-1-AP targets Gamma Tubulin in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, canine samples.
| Tested Reactivity | human, mouse, canine |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag23575 Product name: Recombinant human tubulin-gamma protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 150-451 aa of BC000619 Sequence: GSYLLERLNDRYPKKLVQTYSVFPNQDEMSDVVVQPYNSLLTLKRLTQNADCVVVLDNTALNRIATDRLHIQNPSFSQINQLVSTIMSASTTTLRYPGYMNNDLIGLIASLIPTPRLHFLMTGYTPLTTDQSVASVRKTTVLDVMRRLLQPKNVMVSTGRDRQTNHCYIAILNIIQGEVDPTQVHKSLQRIRERKLANFIPWGPASIQVALSRKSPYLPSAHRVSGLMMANHTSISSLFERTCRQYDKLRKREAFLEQFRKEDMFKDNFDEMDTSREIVQQLIDEYHAATRPDYISWGTQEQ Predict reactive species |
| Full Name | tubulin, gamma 1 |
| Calculated Molecular Weight | 51 kDa |
| Observed Molecular Weight | 50-55 kDa |
| GenBank Accession Number | BC000619 |
| Gene Symbol | Gamma Tubulin |
| Gene ID (NCBI) | 7283 |
| RRID | AB_2880420 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P23258 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Gamma tubulin is a member of tubulin superfamily and is a key component required for microtubule nucleation and stabilization. It is concentrated at the pericentriolar material of centrosomes in interphase cells, predominantly on spindle poles in mitotic cells, while found in midbodies during cytokinesis. Overexpression of gamma tubulin has been found in various cancers including breast cancer and gliomas. This antibody can well label the centrosome structure.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Gamma Tubulin antibody 26195-1-AP | Download protocol |
| IHC protocol for Gamma Tubulin antibody 26195-1-AP | Download protocol |
| WB protocol for Gamma Tubulin antibody 26195-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |















