GSTT1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• GSTT1 Polyclonal antibody (15838-1-AP)

• Featured Product
• KD/KO Validated

GSTT1 Polyclonal Antibody for WB, ELISA

Cat No. 15838-1-AP

Publications(12)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (2)

Applications

WB, IHC, IF, ELISA

Synonyms

EC:2.5.1.18, Glutathione S-transferase theta-1, Glutathione transferase T1 1, Glutathione transferase T1-1, GST class theta 1

• 

  WB analysis of human brain using 15838-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 15838-1-AP (GSTT1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HepG2 using 15838-1-AP

  WB result of GSTT1 antibody (15838-1-AP; 1:600; incubated at room temperature for 1.5 hours) with sh-Control and sh-GSTT1 transfected HepG2 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HepG2 using 15838-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 15838-1-AP (GSTT1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse brain using 15838-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 15838-1-AP (GSTT1 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse liver using 15838-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 15838-1-AP (GSTT1 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of rat liver using 15838-1-AP

  rat liver tissue were subjected to SDS PAGE followed by western blot with 15838-1-AP (GSTT1 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: human brain tissue, HepG2 cells, mouse brain tissue, mouse liver tissue, rat liver tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

15838-1-AP targets GSTT1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, pig, hamster
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8588

  Product name: Recombinant human GSTT1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-240 aa of BC007065

  Sequence: MGLELYLDLLSQPCRAVYIFAKKNDIPFELRIVDLIKGQHLSDACAQVNPLKKVPALKDGDFTLTESVAILLYLTRKYKVPDYWYPQDLQARARVDEYLAWQHTTLRRSCLRALWHKVMFPVFLGEPVSPQTLAATLAELDVTLQLLEDKFLQNKAFLTGPHISLADLVAITELMHPVGAGCQVFEGRPKLATWRQRVEAAVGEDLFQEAHEVILKAKDFPPADPTIKQKLMPWVLAMIR

• Full Name: glutathione S-transferase theta 1
• Calculated Molecular Weight: 240 aa, 27 kDa
• Observed Molecular Weight: 28 kDa, 30 kDa
• GenBank Accession Number: BC007065
• Gene Symbol: GSTT1
• Gene ID (NCBI): 2952
• RRID: AB_2116344
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P30711
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GSTT1 belongs to the GST superfamily and Theta family. It is a conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. GSTT1 acts on 1,2-epoxy-3-(4-nitrophenoxy)propane, phenethylisothiocyanate 4-nitrobenzyl chloride and 4-nitrophenethyl bromide. It displays glutathione peroxidase activity with cumene hydroperoxide. GSTM1 and GSTT1 has been suggested as a risk factor in various cancers. GSTT1 is important in the detoxification of unidentified xenobiotics in the large intestine.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Cell Syst; Rare Disease Mechanisms Identified by Genealogical Proteomics of Copper Homeostasis Mutant Pedigrees.; Authors - Stephanie A Zlatic
mouse	WB	FASEB J; Gstm1/Gstt1 is essential for reducing cisplatin ototoxicity in CBA/CaJ mice.; Authors - Peipei Li ; KO Validated
hamster	IHC	Toxicol Sci; Determination of Hepatotoxicity and Its Underlying Metabolic Basis of 1,2-dichloropropane in Male Syrian Hamsters and B6C3F1 Mice.; Authors - Min Wei
human	WB	Drug Metab Dispos; Evaluation of hepatic glutathione transferase Mu 1 and Theta 1 activities in humans and mice using genotype information.; Authors - Arakawa Shingo S
human	WB	Curr Issues Mol Biol; COPS5 Conferred the Platinum Resistance in Epithelial Ovarian Cancer; Authors - Ming-Wei Lin
mouse	IHC	Int J Clin Exp Pathol; Different carcinogenic process in cholangiocarcinoma cases epidemically developing among workers of a printing company in Japan.; Authors - Yasunori Sato