MAD2L1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• MAD2L1 Polyclonal antibody (10337-1-AP)

• Featured Product
• KD/KO Validated

MAD2L1 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 10337-1-AP Copied!

Publications (42)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

HSMAD2, MAD2, MAD2 like protein 1, MAD2-like protein 1, Mitotic arrest deficient 2-like protein 1

• 

  WB analysis using 10337-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10337-1-AP (MAD2L1 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 10337-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10337-1-AP (MAD2L1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 10337-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10337-1-AP (MAD2L1 antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293 using 10337-1-AP

  WB result of MAD2L1 antibody (10337-1-AP; 1:1200; incubated at room temperature for 1.5 hours) with sh-Control and sh-MAD2L1 transfected HEK-293 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of rat liver using 10337-1-AP

  rat liver tissue were subjected to SDS PAGE followed by western blot with 10337-1-AP (MAD2L1 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HEK-293 using 10337-1-AP

  IP result of anti-MAD2L1 (IP:10337-1-AP, 3ug; Detection:10337-1-AP 1:500) with HEK-293 cells lysate 1800ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 10337-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer using 10337-1-AP (MAD2L1 antibody) at dilution of 1:50 (under 25x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse ovary using 10337-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse ovary tissue slide using 10337-1-AP (MAD2L1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse ovary using 10337-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse ovary tissue slide using 10337-1-AP (MAD2L1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 10337-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer using 10337-1-AP (MAD2L1 antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 10337-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer using 10337-1-AP (MAD2L1 antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary tumor using 10337-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor using 10337-1-AP (MAD2L1 antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary tumor using 10337-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor using 10337-1-AP (MAD2L1 antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary tumor using 10337-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor using 10337-1-AP (MAD2L1 antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 10337-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using MAD2L1 antibody (10337-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HEK-293 using 10337-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HEK-293 cells using 10337-1-AP (MAD2L1 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for MAD2L1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: Daudi cells, rat liver tissue, HEK-293 cells, HepG2 cells, Raji cells, THP-1 cells, HeLa cells, L02 cells
• Positive IP detected in: HEK-293 cells
• Positive IHC detected in: mouse ovary tissue, human liver cancer tissue, human ovary tumor tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells, HEK-293 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:5000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

10337-1-AP targets MAD2L1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0307

  Product name: Recombinant human MAD2L1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 16-185 aa of BC000356

  Sequence: SAEIVAEFFSFGINSILYQRGIYPSETFTRVQKYGLTLLVTTDLELIKYLNNVVEQLKDWLYKCSVQKLVVVISNIESGEVLERWQFDIECDKTAKDDSAPREKSQKAIQDEIRSVIRQITATVTFLPLLEVSCSFDLLIYTDKDLVVPEKWEESGPQFITNSEEVRLRS

• Full Name: MAD2 mitotic arrest deficient-like 1 (yeast)
• Calculated Molecular Weight: 24 kDa
• Observed Molecular Weight: 25-30 kDa
• GenBank Accession Number: BC000356
• Gene Symbol: MAD2L1
• Gene ID (NCBI): 4085
• RRID: AB_2139365
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q13257
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MAD2 mitotic arrest deficient-like 1 (yeast) (MAD2L1, synonyms: MAD2, HSMAD2) is a component of the mitotic spindle assembly checkpoint that prevents the onset of anaphase until all chromosomes are properly aligned at the metaphase plate. MAD2L1 is localized to human chromosome band 5q23.3 by in situ hybridization.

Publications

What published studies show

The MAD2L1 Polyclonal antibody (catalog number 10337-1-AP) has 42 citations. These appear in journals including Cancer Research, Nucleic Acids Research, Advanced Science, Science Advances, Neuro-Oncology, Cell Death & Disease, Cell Death Discovery, Oncogene, International Journal of Surgery, and International Journal of Biological Macromolecules. The associated research fields center on cancer biology (hepatocellular, gastric, ovarian, glioblastoma, and other carcinomas), cell cycle regulation, and the spindle assembly checkpoint, with applications mainly in Western blot and immunohistochemistry.

Automatically generated from the 42 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB,IHC	Cancer Res; Deficiency of pRb family proteins and p53 in invasive urothelial tumorigenesis.; Authors - He Feng F
		Cancer Res; MPHOSPH1: a potential therapeutic target for hepatocellular carcinoma.; Authors - Xinran Liu
human	WB,IF	Nucleic Acids Res; ULK1 phosphorylates Mad1 to regulate spindle assembly checkpoint.; Authors - Fengjie Yuan
human	WB,IF	Adv Sci (Weinh); A Novel FGFR3-Targeting Antibody-Drug Conjugate Induces Tumor Cell Apoptosis through the cGAS-STING Pathway in Bladder Cancer.; Authors - Shu Cui ; KD Validated
human	WB	Adv Sci (Weinh); CCDC68 Maintains Mitotic Checkpoint Activation by Promoting CDC20 Integration into the MCC; Authors - Qi Li
mouse	WB,IF	Adv Sci (Weinh); A Microtubule-Associated Protein Functions in Preventing Oocytes from Evading the Spindle Assembly Checkpoint; Authors - Changyin Zhou