• Featured Product
  • KD/KO Validated

Calnexin Polyclonal antibody

Calnexin Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), ELISA
Cat No. 10427-2-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (4)

Applications

WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA

CANX, CNX, IP90, Major histocompatibility complex class I antigen-binding protein p88, P90

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293 cells, HepG2 cells, HeLa cells, K-562 cells, MCF-7 cells, NIH/3T3 cells, U2OS cells, RAW 264.7 cells
Positive IHC detected inhuman breast cancer tissue, human cervical cancer tissue, human colon tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inU2OS cells, HepG2 cells, SKOV-3 cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10427-2-AP targets Calnexin in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, pig, monkey, hamster, goat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0697

Product name: Recombinant human Calnexin protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-273 aa of BC003552

Sequence: MEGKWLLCMLLVLGTAIVEAHDGHDDDVIDIEDDLDDVIEEVEDSKPDTTAPPSSPKVTYKAPVPTGEVYFADSFDRGTLSGWILSKAKKDDTDDEIAKYDGKWEVEEMKESKLPGDKGLVLMSRAKHHAISAKLNKPFLFDTKPLIVQYEVNFQNGIECGGAYVKLLSKTPELNLDQFHDKTPYTIMFGPDKCGEDYKLHFIFRHKNPKTGIYEEKHAKRPDADLKTYFTDKKTHLYTLILNPDNSFEILVDQSVVNSGNLLNDMTPPVNPS

Predict reactive species
Full Name calnexin
Calculated Molecular Weight 90 kDa
Observed Molecular Weight 90 kDa
GenBank Accession NumberBC003552
Gene Symbol Calnexin
Gene ID (NCBI) 821
RRIDAB_2069033
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP27824
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Calnexin is a molecular chaperone that resides in the endoplasmic reticulum (ER) and participates in the folding and assembly of newly synthesized proteins. Calnexin is highly abundant in ER and is frequently used as an ER marker.

Protocols

Product Specific Protocols
FC protocol for Calnexin antibody 10427-2-APDownload protocol
IF protocol for Calnexin antibody 10427-2-APDownload protocol
IHC protocol for Calnexin antibody 10427-2-APDownload protocol
WB protocol for Calnexin antibody 10427-2-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIF

Nature

A virally encoded high-resolution screen of cytomegalovirus dependencies

Authors - Yaara Finkel
humanWB

Cell Res

Mitochondria-localized cGAS suppresses ferroptosis to promote cancer progression

Authors - Shiqiao Qiu
mouseWB

Cell Res

Disruption of ER ion homeostasis maintained by an ER anion channel CLCC1 contributes to ALS-like pathologies

Authors - Liang Guo
humanWB

Mol Cancer

Exosomal circ_0006896 promotes AML progression via interaction with HDAC1 and restriction of antitumor immunity

Authors - Can Can
humanWB

Cell Discov

A RIPK3-independent role of MLKL in suppressing parthanatos promotes immune evasion in hepatocellular carcinoma

Authors - Xifei Jiang

Immunity

The nucleotide receptor STING translocates to the phagosomes to negatively regulate anti-fungal immunity

Authors - Tian Chen

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Zakia (Verified Customer) (01-06-2026)

The Calnexin rabbit polyclonal antibody performed excellently in our study using mouse brain samples. The antibody produced a strong and specific signal, with a clearly defined band at approximately 90 kDa, which is consistent with the expected molecular weight of Calnexin. Background signal was minimal, allowing for confident interpretation of results.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:3000
  • Cell Tissue Type: mice nipsnap brain sample
Calnexin Antibody Western Blot validation (1:3000 dilution) in mice nipsnap brain sample (Cat no:10427-2-AP)
FH

Guo-rong (Verified Customer) (02-06-2023)

Clear bands can be detected in total cell lysates rather than in extracellular vesicles, as a good EV exclusive marker

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:5000
  • Cell Tissue Type: ARPE-19
Calnexin Antibody Western Blot validation (1:5000 dilution) in ARPE-19 (Cat no:10427-2-AP)
FH

Saba (Verified Customer) (03-14-2022)

The band of the antibody was so sharp and specific. The dilution I used was 1:4000 and it worked perfectly.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:4000
FH

Meliti (Verified Customer) (09-25-2019)

1:1000 dilution in 5%milk PBST O/N incubation for all antibodies depicted which all come from Proteintech 1:5000 anti rabbit HRP in 5%milk PBST for 1h

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Human HEK293 WCEs and exosomes released from these cells and purified by size exclusion chromatography
Calnexin Antibody Western Blot, validation (1:1000 dilution) in Human HEK293 WCEs and exosomes released from these cells and purified by size exclusion chromatography (Cat no:10427-2-AP)
Loading...
||
New chat

Able

正在加载,请稍候...