BAD Polyclonal antibody

BAD Polyclonal Antibody for WB, IHC, FC (Intra), ELISA
Cat No. 10435-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (4)

Applications

WB, IHC, FC (Intra), ELISA

BBC2, BBC6, Bcl2-associated agonist of cell death, Bcl-2-binding component 6, BCL2L8

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, HepG2 cells, Jurkat cells, Neuro-2a cells, L02 cells, NIH/3T3 cells
Positive IHC detected inhuman prostate hyperplasia tissue, human prostate cancer tissue, mouse liver tissue, human lymphoma tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive FC (Intra) detected inJurkat cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:3000
Immunohistochemistry (IHC)IHC : 1:100-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10435-1-AP targets BAD in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse, rat, pig, canine, sheep
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0688

Product name: Recombinant human BAD protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 14-168 aa of BC001901

Sequence: DSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASHQQEQPTSSSHHGGAGAVEIRSRHSSYPAGTEDDEGMGEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ

Predict reactive species
Full Name BCL2-associated agonist of cell death
Calculated Molecular Weight 18 kDa
Observed Molecular Weight 18-25 kDa
GenBank Accession NumberBC001901
Gene Symbol BAD
Gene ID (NCBI) 572
RRIDAB_2061994
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ92934
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

BAD, also named as BBC6 and BCL2L8, promotes cell death. It is successfully competes for the binding to Bcl-X(L), Bcl-2 and Bcl-W, thereby affecting the level of heterodimerization of these proteins with BAX. BAD can reverse the death repressor activity of Bcl-X(L), but not that of Bcl-2. It appears to act as a link between growth factor receptor signaling and the apoptotic pathways.

Protocols

Product Specific Protocols
FC protocol for BAD antibody 10435-1-APDownload protocol
IHC protocol for BAD antibody 10435-1-APDownload protocol
WB protocol for BAD antibody 10435-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Carbohydr Polym

A multi-bioresponsive self-assembled nano drug delivery system based on hyaluronic acid and geraniol against liver cancer

Authors - Shaofeng Duan
humanWB

Oxid Med Cell Longev

Dihydroartemisinin Modulates Apoptosis and Autophagy in Multiple Myeloma through the P38/MAPK and Wnt/β-Catenin Signaling Pathways.

Authors - Xiuhua Wu
humanWB

Oxid Med Cell Longev

Cystathionine β-Synthase Regulates the Proliferation, Migration, and Invasion of Thyroid Carcinoma Cells.

Authors - Qi-Ying Jiang
humanWB

Int J Nanomedicine

Synergism of cisplatin-oleanolic acid co-loaded calcium carbonate nanoparticles on hepatocellular carcinoma cells for enhanced apoptosis and reduced hepatotoxicity.

Authors - Muhammad Waseem Khan
humanWB

Cell Death Dis

CRB3 regulates contact inhibition by activating the Hippo pathway in mammary epithelial cells.

Authors - Xiaona Mao
humanWB

Int J Oncol

CUDC‑101 is a potential target inhibitor for the EGFR‑overexpression bladder cancer cells

Authors - Zhenxing Wang

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Sai Sindhura (Verified Customer) (01-08-2026)

BAD is very good antibody

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
FH

Mounika (Verified Customer) (01-08-2026)

Wonderful and best antibodies, easy to work with!

  • Applications: Western Blot, Immunohistochemistry, Immunofluorescence
  • Primary Antibody Dilution: 1:400
FH

Carly (Verified Customer) (11-17-2020)

Tested using EDTA plasma on an antibody microarray

  • Applications: Other
Loading...
||
New chat

Able

正在加载,请稍候...