• Featured Product
  • KD/KO Validated

Alpha Synuclein Polyclonal antibody

Alpha Synuclein Polyclonal Antibody for WB, IHC, IF/ICC, IF-Fro, ELISA
Cat No. 10842-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (2)

Applications

WB, IHC, IF/ICC, IF-Fro, IP, CoIP, ELISA

1, a-synuclein, SNCA, alpha syn, alpha-syn

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse brain tissue, human brain tissue, rat brain tissue
Positive IHC detected inmouse brain tissue, human kidney tissue, human placenta tissue, human testis tissue, human skin tissue, human lung tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-Fro detected inrat brain tissue
Positive IF/ICC detected inSH-SY5Y cells
Positive FC (Intra) detected inSH-SY5Y cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)-FROIF-FRO : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10842-1-AP targets Alpha Synuclein in WB, IHC, IF/ICC, IF-Fro, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, yeast, zebra finch
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag1285

Product name: Recombinant human a-Synuclein protein

Source: e coli.-derived, PKG

Tag: GST

Domain: 1-140 aa of BC013293

Sequence: MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA

Predict reactive species
Full Name synuclein, alpha (non A4 component of amyloid precursor)
Calculated Molecular Weight 14 kDa
Observed Molecular Weight 15-19 kDa
GenBank Accession NumberBC013293
Gene Symbol Alpha Synuclein
Gene ID (NCBI) 6622
RRIDAB_2192672
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP37840
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Alpha Synuclein (α-syn) is a 14-19 kDa phosphoprotein that is primarily localize to the presynaptic terminals of mature neurons, where it is involved in synaptic function and plasticity. Α-syn has drawn intense interest ever since the late 1990s, when the first α-synuclein missense mutation was identified as a cause of familial Parkinson's disease (PD). Aggregated and hyper-phosphorylated forms of α-syn protein are the pathological hallmark of Lewy body disease, which includes Parkinson's disease (PD), diffuse Lewy body disease (DLBD), and Lewy body variant of Alzheimer's disease (LBV). This antibody can recognize all the isoforms of α-syn.

Protocols

Product Specific Protocols
FC protocol for Alpha Synuclein antibody 10842-1-APDownload protocol
IF protocol for Alpha Synuclein antibody 10842-1-APDownload protocol
IHC protocol for Alpha Synuclein antibody 10842-1-APDownload protocol
WB protocol for Alpha Synuclein antibody 10842-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Transl Neurodegener

Reciprocal effects of alpha-synuclein aggregation and lysosomal homeostasis in synucleinopathy models

Authors - Alice Drobny
mouseIF

Aging Dis

MSC-Derived Exosomes can Enhance the Angiogenesis of Human Brain MECs and Show Therapeutic Potential in a Mouse Model of Parkinson's Disease.

Authors - Chunling Xue
humanIHC

Acta Neuropathol Commun

Mixed pathologies in pancreatic β cells from subjects with neurodegenerative diseases and their interaction with prion protein.

Authors - Ivan Martinez-Valbuena
mouseWB,IHC

Aging Cell

Poly (ADP-ribose) polymerase 1 inhibition prevents neurodegeneration and promotes α-synuclein degradation via transcription factor EB-dependent autophagy in mutant α-synucleinA53T model of Parkinson's disease.

Authors - Kanmin Mao
humanWB

Acta Pharmacol Sin

Roflupram protects against rotenone-induced neurotoxicity and facilitates α-synuclein degradation in Parkinson's disease models.

Authors - Wen-Li Dong
mouseWB,IHC,IF

J Neurosci

Mutant alpha-synuclein causes age-dependent neuropathology in monkey brain.

Authors - Weili Yang

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Boyan (Verified Customer) (01-13-2026)

good for WB

  • Applications: Western Blot
  • Cell Tissue Type: human
FH

Angie (Verified Customer) (01-20-2025)

The antibody detected a band around 20 kD at dilution of 1:1000 incubated overnight at 4 °C followed by 1h incubation of the secondary antibody donkey-anti-rabbit (Alexa Fluor 800, used at 1:20000 dilution) at room temperature.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: SHSY-5Y
Alpha Synuclein Antibody Western Blot validation (1:1000 dilution) in SHSY-5Y (Cat no:10842-1-AP)
FH

Sheela (Verified Customer) (07-16-2019)

This antibody works as expected!

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Mouse brain RIPA lysate
Alpha Synuclein Antibody Western Blot, validation (1:1000 dilution) in Mouse brain RIPA lysate (Cat no:10842-1-AP)
Loading...
||
New chat

Able

正在加载,请稍候...