• Featured Product
  • KD/KO Validated

Palladin Polyclonal antibody

Palladin Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, ELISA
Cat No. 10853-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF/ICC, FC (Intra), IP, COIP, ELISA

PALLD, PALLD,palladin, CGI 151, CGI-151, KIAA0992

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, A549 cells
Positive IP detected inHeLa cells, HEK-293 cells
Positive IHC detected inhuman colon cancer tissue, human breast cancer tissue, human colon tissue, human ovary tumor tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10853-1-AP targets Palladin in WB, IHC, IF/ICC, FC (Intra), IP, COIP, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag1288

Product name: Recombinant human PALLD,palladin protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 127-510 aa of BC013867

Sequence: APFFEMKLKHYKIFEGMPVTFTCRVAGNPKPKIYWFKDGKQISPKSDHYTIQRDLDGTCSLHTTASTLDDDGNYTIMAANPQGRISCTGRLMVQAVNQRGRSPRSPSGHPHVRRPRSRSRDSGDENEPIQERFFRPHFLQAPGDLTVQEGKLCRMDCKVSGLPTPDLSWQLDGKPVRPDSAHKMLVRENGVHSLIIEPVTSRDAGIYTCIATNRAGQNSFSLELVVAAKEAHKPPVFIEKLQNTGVADGYPVRLECRVLGVPPPQIFWKKENESLTHSTDRVSMHQDNHGYICLLIQGATKEDAGWYTVSAKNEAGIVSCTARLDVYTQWHQQSQSTKPKKVRPSASRYAALSDQGLDIKAAFQPEANPSHLTLNTALVESEDL

Predict reactive species
Full Name palladin, cytoskeletal associated protein
Calculated Molecular Weight 1383 aa, 151 kDa
Observed Molecular Weight 95 kDa, 140 kDa
GenBank Accession NumberBC013867
Gene Symbol palladin
Gene ID (NCBI) 23022
RRIDAB_2158782
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ8WX93
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Palladin is an actin associated protein serving as a cytoskeleton scaffold, and actin cross linker, localizing at stress fibers, focal adhesions, and other actin based structures. Palladin exists as multiple isoforms through alternative transcription initiation sites and splicing. There are three major isoforms (200, 140, 90-92 kDa) and multiple minor isoforms. Different palladin isoforms are expressed in a tissue-specific pattern during development and in adult organs: the 200 kDa isoform is predominantly expressed in the heart, skeletal muscle, testis and bone; the 140 kDa isoform is widely expressed with the exception of liver, muscle, and skin; the 90-92 kDa isoform is broadly expressed in embryonic tissues and highly expressed in adult smooth muscle tissues (21455759). Recently overexpression of palladin has been linked to the promoted invasive motility in several types of cancers (18978809, 22291919). The 85-90 kDa palladin isoform has been observed predominantly expressed in pancreatic ductal adenocarcinoma (PDA) while a 65 kDa isoform is expressed in normal pancreas and non-PDA tumors (20436683). This antibody, generated against the fragment 999-1383aa of palladin, recognizes most isoforms of this protein, except isoform 6.

Protocols

Product Specific Protocols
FC protocol for Palladin antibody 10853-1-APDownload protocol
IF protocol for Palladin antibody 10853-1-APDownload protocol
IHC protocol for Palladin antibody 10853-1-APDownload protocol
IP protocol for Palladin antibody 10853-1-APDownload protocol
WB protocol for Palladin antibody 10853-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIP

Mol Cell

The actin-bundling protein palladin is an Akt1-specific substrate that regulates breast cancer cell migration.

Authors - Chin Y Rebecca YR
mouse,humanWB,IHC

Nat Commun

Local microRNA delivery targets Palladin and prevents metastatic breast cancer.

Authors - Avital Gilam
  • KD Validated
humanWB

Cell Death Differ

lncRNA THAP7-AS1, transcriptionally activated by SP1 and post-transcriptionally stabilized by METTL3-mediated m6A modification, exerts oncogenic properties by improving CUL4B entry into the nucleus.

Authors - Hai-Ting Liu
humanIF

J Am Soc Nephrol

The Role of Palladin in Podocytes.

Authors - Nadine Artelt
humanIHC

Cancer Res

Cofilin Drives Cell Invasive and Metastatic Responses to TGF-β in Prostate Cancer.

Authors - Joanne Collazo
humanWB,IHC,IF

Oncogene

Twist1-induced activation of human fibroblasts promotes matrix stiffness by upregulating palladin and collagen α1(VI).

Authors - I García-Palmero
  • KD Validated
Loading...
||
New chat

Able

正在加载,请稍候...