• Featured Product
  • KD/KO Validated

Galectin-3 Polyclonal antibody

Galectin-3 Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, ELISA
Cat No. 14979-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, FC (Intra), IP, ELISA

35 kDa lectin, Carbohydrate-binding protein 35, CBP 35, CBP35, Gal 3

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, human heart tissue, rat colon tissue, MCF-7 cells, NIH/3T3 cells
Positive IP detected inMCF-7 cells
Positive IHC detected inhuman thyroid cancer tissue, human colon tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

14979-1-AP targets Galectin-3 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, pig
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag6891

Product name: Recombinant human Galectin 3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-250 aa of BC001120

Sequence: MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI

Predict reactive species
Full Name lectin, galactoside-binding, soluble, 3
Calculated Molecular Weight 26 kDa
Observed Molecular Weight 31 kDa
GenBank Accession NumberBC001120
Gene Symbol Galectin-3
Gene ID (NCBI) 3958
RRIDAB_2136768
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP17931
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Galectins are a family of animal lectins defined by shared characteristic amino-acid sequences and affinity for β-galactose-containing oligosac-charides (PMID: 8063692). Galectin-3, a member of the β-galactoside-binding proteins, contains one carbohydrate recognition domain (CRD) and a proline- and glycine-rich N-terminal domain through which is able to form oligomers (PMID: 14758078). Galectin-3 is widely expressed in many normal tissues and a variety of tumors. It is found intracellularly in nucleus and cytoplasm or secreted outside of cell, being present on the cell surface or in the extracellular space (PMID: 16478649). Galectin-3 is involved in various biological processes including cell growth, adhesion, differentiation, apoptosis, angiogenesis, immune response, neoplastic transformation and metastasis (PMID: 16478649; 14758078).

Protocols

Product Specific Protocols
FC protocol for Galectin-3 antibody 14979-1-APDownload protocol
IF protocol for Galectin-3 antibody 14979-1-APDownload protocol
IHC protocol for Galectin-3 antibody 14979-1-APDownload protocol
IP protocol for Galectin-3 antibody 14979-1-APDownload protocol
WB protocol for Galectin-3 antibody 14979-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIF

Nature

A phosphoinositide signalling pathway mediates rapid lysosomal repair

Authors - Jay Xiaojun Tan
mouseWB

Nat Immunol

Heme drives hemolysis-induced susceptibility to infection via disruption of phagocyte functions.

Authors - Rui Martins
mouseIF

Redox Biol

Cathepsin C from extracellular histone-induced M1 alveolar macrophages promotes NETosis during lung ischemia-reperfusion injury

Authors - Jing Yu
mouseIF

Br J Pharmacol

Substitution of the SERCA2 Cys(674) reactive thiol accelerates atherosclerosis by inducing endoplasmic reticulum stress and inflammation

Authors - Hang Su
humanIF

J Neuroinflammation

Progranulin haploinsufficiency mediates cytoplasmic TDP-43 aggregation with lysosomal abnormalities in human microglia

Authors - Wonjae Sung
WB

Acta Pharmacol Sin

Modified citrus pectin inhibits breast cancer development in mice by targeting tumor-associated macrophage survival and polarization in hypoxic microenvironment

Authors - Lei Wang

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Víctor (Verified Customer) (09-18-2024)

The staining appears specific, although there is a bit of background, maybe due to the secondary antibody used. It is quite similar to the staining shown on the product's website

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:200
  • Cell Tissue Type: Reactive astrocites
FH

Tom (Verified Customer) (07-07-2021)

HEK293 whole cell lysates on SDS-PAGE. Antibody incubated with membrane overnight in fridge. HRP secondary antibody used for detection.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: HEK293
Galectin-3 Antibody Western Blot validation (1:1000 dilution) in HEK293 (Cat no:14979-1-AP)
Loading...
||
New chat

Able

正在加载,请稍候...