Tested Applications
| Positive WB detected in | PC-12 cells, PC-12 |
| Positive IHC detected in | mouse brain tissue, mouse cerebellum tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive FC (Intra) detected in | SH-SY5Y cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
20332-1-AP targets Adenosine A1 Receptor in WB, IHC, IF, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag14092 Product name: Recombinant human ADORA1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 184-243 aa of BC026340 Sequence: NFFVWVLPPLLLMVLIYLEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALILFLF Predict reactive species |
| Full Name | adenosine A1 receptor |
| Calculated Molecular Weight | 326 aa, 37 kDa |
| Observed Molecular Weight | 40 and 45 kDa |
| GenBank Accession Number | BC026340 |
| Gene Symbol | Adenosine A1 Receptor |
| Gene ID (NCBI) | 134 |
| RRID | AB_2878673 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P30542 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
ADORA1, also named as RDC7, is a receptor for adenosine. It is mediated by G proteins which inhibit adenylyl cyclase. Adenosine is an important mediator of ethanol intoxication and exerts some of its effects via ADORA1 in the central nervous system.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for Adenosine A1 Receptor antibody 20332-1-AP | Download protocol |
| IHC protocol for Adenosine A1 Receptor antibody 20332-1-AP | Download protocol |
| WB protocol for Adenosine A1 Receptor antibody 20332-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The Adenosine A1 Receptor Polyclonal antibody (Cat# 20332-1-AP) has 9 citations published in journals including Cell Research, Journal of Allergy and Clinical Immunology, Journal of Orthopaedic Translation, Neuroscience Bulletin, Drug Design, Development and Therapy, Cell Biology and Toxicology, International Immunopharmacology, American Journal of Physiology, and PLoS ONE. Research fields span pain neuroscience, allergic inflammation, osteoarthritis, thermal homeostasis, ulcerative colitis, liver injury, spinal cord injury, purine metabolism, and tumor immunology.
| Species | Application | Title |
|---|---|---|
Cell Res 40 Hz light flickering alleviates chronic pain via adenosine signaling in the retina-amygdala pathway. | ||
J Allergy Clin Immunol Traffic-emitted ultrafine particles disrupt macrophage efferocytosis and resolution of allergic lung inflammation. | ||
J Orthop Translat CD73 alleviates osteoarthritis by maintaining anabolism and suppressing catabolism of chondrocytes extracellular matrix | ||
Neurosci Bull Delta-Band Dynamics of CaMKI-Positive Preoptic Neurons Encode Thermal Homeostatic Information. | ||
Drug Des Devel Ther Cordycepin Ameliorates Dextran Sulfate Sodium-Induced Ulcerative Colitis in Mice by Inhibiting IL-6/IL-6R-Mediated p38 MAPK and NF-κB Activation Through Adenosine A(2A) Receptor Stimulation. | ||
Cell Biol Toxicol Adenosine kinase protects against acetaminophen-induced acute liver injury by activating autophagy in hepatocytes |
