• Featured Product
  • KD/KO Validated

ALDH1A1 Polyclonal antibody

ALDH1A1 Polyclonal Antibody for WB, IHC, IF/ICC, IF-P, FC (Intra), ELISA
Cat No. 15910-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, IF-P, FC (Intra), CoIP, ELISA

3-deoxyglucosone dehydrogenase, ALDC, Aldehyde dehydrogenase 1A1, ALDH 1A1, ALDH1 A1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inK-562 cells, rat liver tissue, mouse liver tissue
Positive IHC detected inmouse testis tissue, human liver tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse colon tissue, mouse testis tissue
Positive IF/ICC detected inA549 cells
Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

15910-1-AP targets ALDH1A1 in WB, IHC, IF/ICC, IF-P, FC (Intra), CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, bovine
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag8665

Product name: Recombinant human ALDH1A1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 153-501 aa of BC001505

Sequence: TYTRHEPIGVCGQIIPWNFPLVMLIWKIGPALSCGNTVVVKPAEQTPLTALHVASLIKEAGFPPGVVNIVPGYGPTAGAAISSHMDIDKVAFTGSTEVGKLIKEAAGKSNLKRVTLELGGKSPCIVLADADLDNAVEFAHHGVFYHQGQCCIAASRIFVEESIYDEFVRRSVERAKKYILGNPLTPGVTQGPQIDKEQYDKILDLIESGKKEGAKLECGGGPWGNKGYFVQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKSLDDVIKRANNTFYGLSAGVFTKDIDKAITISSALQAGTVWVNCYGVVSAQCPFGGFKMSGNGRELGEYGFHEYTEVKTVTVKISQKNS

Predict reactive species
Full Name aldehyde dehydrogenase 1 family, member A1
Calculated Molecular Weight 501 aa, 55 kDa
Observed Molecular Weight 50-55 kDa
GenBank Accession NumberBC001505
Gene Symbol ALDH1A1
Gene ID (NCBI) 216
RRIDAB_2305276
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP00352
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ALDH1A1(Aldehyde dehydrogenase family 1 member A1 ), also named as ALDC, ALDH1 and PUMB1, belongs to the aldehyde dehydrogenase family. The ALDH1A1 gene encodes a liver cytosolic isoform of acetaldehyde dehydrogenase, an enzyme involved in the major pathway of alcohol metabolism after alcohol dehydrogenase. ALDH1A1 plays a critical role in protection against oxidative stress-induced cytotoxicity in lens epithelial cells(PMID:19296407). And it is important for multiple biological activities including drug resistance, cell differentiation, and oxidative stress response(PMID:19025616). As a novel cancer stem cell marker, ALDH1A1 can be used for tumors whose corresponding normal tissues express ALDH1 in relatively restricted or limited levels such as breast, lung, ovarian or colon cancer(PMID: 20422001). This antibody can also recognize some other membranes of the aldehyde dehydrogenase family.

Protocols

Product Specific Protocols
FC protocol for ALDH1A1 antibody 15910-1-APDownload protocol
IF protocol for ALDH1A1 antibody 15910-1-APDownload protocol
IHC protocol for ALDH1A1 antibody 15910-1-APDownload protocol
WB protocol for ALDH1A1 antibody 15910-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Cell Res

Excessive UBE3A dosage impairs retinoic acid signaling and synaptic plasticity in autism spectrum disorders.

Authors - Xingxing Xu
mouseWB

Mol Cell

Maternal Aldehyde Elimination during Pregnancy Preserves the Fetal Genome.

Authors - Nina Oberbeck
humanWB,IHC,IF

Int J Oral Sci

LIMP-2 enhances cancer stem-like cell properties by promoting autophagy-induced GSK3β degradation in head and neck squamous cell carcinoma

Authors - Yuantong Liu
humanWB,IHC

Nat Commun

TSPAN8 promotes cancer cell stemness via activation of sonic Hedgehog signaling.

Authors - Rongxuan Zhu
mouse,humanWB,IHC,IF

J Pineal Res

Melatonin inhibits the stemness of head and neck squamous cell carcinoma by modulating HA synthesis via the FOSL1/HAS3 axis

Authors - Xinyue Luo
humanIF

EMBO J

RASSF1C oncogene elicits amoeboid invasion, cancer stemness, and extracellular vesicle release via a SRC/Rho axis.

Authors - Maria Laura Tognoli

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Irshad (Verified Customer) (07-23-2025)

I have used the ALDH1A1 antibody extensively for immunohistochemistry (IHC) on mouse tissue (small and large intestine), and I am very pleased with its performance. The antibody provides robust, specific, and reproducible staining, particularly in epithelial compartments where ALDH1A1 is known to be expressed. The signal intensity is strong with minimal background, and it clearly distinguishes crypt-resident epithelial cells with cytoplasmic localization, consistent with ALDH1A1's enzymatic role in retinoic acid biosynthesis. Tissue preparation and protocol compatibility were straightforward — the antibody worked well with both paraffin-embedded and frozen sections, following standard antigen retrieval (citrate buffer, pH 6.0, microwave treatment). I typically used it at a dilution of 1:100, and it performed consistently across multiple biological replicates. In summary, this antibody has been a reliable tool for visualizing ALDH1A1 expression in gut epithelial cells. I highly recommend it for researchers interested in epithelial biology, vitamin A metabolism, or retinoic acid signaling.

  • Applications: Immunohistochemistry
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: mice tissue
ALDH1A1 Antibody Immunohistochemistry validation (1:100 dilution) in mice tissue (Cat no:15910-1-AP)
FH

Shinford Z. (Verified Customer) (01-31-2024)

The antibody performs exceptionally well; the band on the membrane is remarkably distinct.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Cancer cell lines
ALDH1A1 Antibody Western Blot validation (1:1000 dilution) in Cancer cell lines (Cat no:15910-1-AP)
FH

Matthew (Verified Customer) (08-07-2023)

Antibody worked perfectly with overnight incubation at 4C. Diluted 1:1000 in TBST.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Mouse mammary epithelial cell
FH

Udesh (Verified Customer) (02-24-2023)

Worked well at 1:1000 in 5% BSA O/N at 4 degrees

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: U2OS Osteosarcoma cells
ALDH1A1 Antibody Western Blot validation (1:1000 dilution) in U2OS Osteosarcoma cells (Cat no:15910-1-AP)
FH

Susmita (Verified Customer) (09-17-2020)

Antibody is working good for WB

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000 WB;
FH

Mario Armando (Verified Customer) (02-18-2020)

I used this ALDH1A1 antibody on different human and mouse tissues including adipose tissue, heart and skeletal muscle. It worked wonderfully even when using paraffin embedded sections in both human and mouse.

  • Applications: Immunofluorescence,
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: OCT embedded frozen section of Human Adipose tissue
ALDH1A1 Antibody Immunofluorescence, validation (1:100 dilution) in OCT embedded frozen section of Human Adipose tissue (Cat no:15910-1-AP)
FH

Joleen (Verified Customer) (06-07-2019)

Prominent band correspond to ALDH1A1. Works well in western blot.

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:1k
  • Cell Tissue Type: MDCK GII
ALDH1A1 Antibody Western Blot, validation (1:1k dilution) in MDCK GII (Cat no:15910-1-AP)
Loading...
||
New chat

Able

正在加载,请稍候...