• Featured Product
  • KD/KO Validated

ARF4 Polyclonal antibody

ARF4 Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Cat No. 11673-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), IP, ELISA

ARF2, ADP-ribosylation factor 4, ADP ribosylation factor 4

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 647
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHT-29 cells, HeLa cells, HepG2 cells, K-562 cells, mouse brain tissue, rat brain tissue
Positive IP detected inHepG2 cells, mouse brain tissue
Positive IHC detected inhuman breast cancer tissue, mouse brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells
Positive FC (Intra) detected inK-562 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

11673-1-AP targets ARF4 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag2272

Product name: Recombinant human ARF4 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-180 aa of BC003364

Sequence: MGLTISSLFSRLFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVGGQDRIRPLWKHYFQNTQGLIFVVDSNDRERIQEVADELQKMLLVDELRDAVLLLFANKQDLPNAMAISEMTDKLGLQSLRNRTWYVQATCATQGTGLYEGLDWLSNELSKR

Predict reactive species
Full Name ADP-ribosylation factor 4
Calculated Molecular Weight 180 aa, 21 kDa
Observed Molecular Weight 16 kDa, 21 kDa
GenBank Accession NumberBC003364
Gene Symbol ARF4
Gene ID (NCBI) 378
RRIDAB_2058463
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP18085
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ARF4, also named as ARF2, belongs to the small GTPase superfamily and Arf family. ADP-ribosylation factors (ARFs) are members of the ARF family of GTP-binding proteins of the Ras superfamily, with 20 kDa protein size. ARFs bind and regulate GTP/GDP cycle by alternating between the active GTP-bound and inactive GDP-bound conformations. ARF family proteins are essential and ubiquitous in eukaryotes. Six highly conserved members of the family have been identified in mammalian cells. They function in vesicular traffic and actin remodelling and other bioprocesses in cells. ARF4 and ARF5 are class II ARFs. Their function are not fully described. (PMID: 7759471, PMID: 16042562). This antibody can bind ARFs for the close sequences.

Protocols

Product Specific Protocols
WB protocol for ARF4 antibody 11673-1-APDownload protocol
IHC protocol for ARF4 antibody 11673-1-APDownload protocol
IF protocol for ARF4 antibody 11673-1-APDownload protocol
IP protocol for ARF4 antibody 11673-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Nat Cell Biol

A CREB3-ARF4 signalling pathway mediates the response to Golgi stress and susceptibility to pathogens.

Authors - Reiling Jan H JH
MouseIHC

Cell Metab

Hypomorphism for RPGRIP1L, a Ciliary Gene Vicinal to the FTO Locus, Causes Increased Adiposity in Mice.

Authors - George Stratigopoulos
humanWB

Sci Adv

p53 loss activates prometastatic secretory vesicle biogenesis in the Golgi.

Authors - Xiaochao Tan
mouseWB

Nat Commun

Ciliary membrane proteins traffic through the Golgi via a Rabep1/GGA1/Arl3-dependent mechanism.

Authors - Hyunho Kim
humanWB

Proc Natl Acad Sci U S A

Whole-genome RNAi screen highlights components of the endoplasmic reticulum/Golgi as a source of resistance to immunotoxin-mediated cytotoxicity.

Authors - Matteo Pasetto
  • KD Validated
humanWB

Cell Rep

KDEL Receptors Assist Dengue Virus Exit from the Endoplasmic Reticulum.

Authors - Ming Yuan Li
Loading...
||
New chat Able
正在加载,请稍候...