Tested Applications
Positive WB detected in | A431 cells |
Positive IHC detected in | human stomach cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | A431 cells |
Positive FC (Intra) detected in | A431 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 1 publications below |
Product Information
11728-1-AP targets CHCHD1 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag2325 Product name: Recombinant human CHCHD1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-118 aa of BC020852 Sequence: MATPSLRGRLARFGNPRKPVLKPNKPLILANRVGERRREKGEATCITEMSVMMACWKQNEFRDDACRKEIQGFLDCAARAQEARKMRSIQETLGESGSLLPNKLNKLLQRFPNKPYLS Predict reactive species |
Full Name | coiled-coil-helix-coiled-coil-helix domain containing 1 |
Calculated Molecular Weight | 13 kDa |
Observed Molecular Weight | 13 kDa |
GenBank Accession Number | BC020852 |
Gene Symbol | CHCHD1 |
Gene ID (NCBI) | 118487 |
RRID | AB_2079769 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q96BP2 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for CHCHD1 antibody 11728-1-AP | Download protocol |
IHC protocol for CHCHD1 antibody 11728-1-AP | Download protocol |
IF protocol for CHCHD1 antibody 11728-1-AP | Download protocol |
FC protocol for CHCHD1 antibody 11728-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
iScience Supernumerary proteins of the human mitochondrial ribosomal small subunit are integral for assembly and translation | ||