• Featured Product
  • KD/KO Validated

Chromogranin B Polyclonal antibody

Chromogranin B Polyclonal Antibody for WB, IHC, IF-P, IF-Fro, FC (Intra), ELISA

Cat No. 14968-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, IF-Fro, FC (Intra), ELISA

CgB, CHGB, SCG1, Chromogranin-B, PE-11

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inNIH/3T3 cells, mouse brain tissue, RAW 264.7 cells
Positive IHC detected inhuman pancreas tissue, mouse pancreas tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse colon tissue
Positive IF-Fro detected inmouse colon tissue
Positive FC (Intra) detected inPC-12 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunohistochemistry (IHC)IHC : 1:20-1:200
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Immunofluorescence (IF)-FROIF-FRO : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

14968-1-AP targets Chromogranin B in WB, IHC, IF-P, IF-Fro, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag6833

Product name: Recombinant human CHGB protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 328-677 aa of BC000375

Sequence: HSTHYRASEEEPEYGEEIKGYPGVQAPEDLEWERYRGRGSEEYRAPRPQSEESWDEEDKRNYPSLELDKMAHGYGEESEEERGLEPGKGRHHRGRGGEPRAYFMSDTREEKRFLGEGHHRVQENQMDKARRHPQGAWKELDRNYLNYGEEGAPGKWQQQGDLQDTKENREEARFQDKQYSSHHTAEKRKRLGELFNPYYDPLQWKSSHFERRDNMNDNFLEGEEENELTLNEKNFFPEYNYDWWEKKPFSEDVNWGYEKRNLARVPKLDLKRQYDRVAQLDQLLHYRKKSAEFPDFYDSEEPVSTHQEAENEKDRADQTVLTEDEKKELENLAAMDLELQKIAEKFSQRG

Predict reactive species
Full Name chromogranin B (secretogranin 1)
Calculated Molecular Weight 78 kDa
Observed Molecular Weight 70-100 kDa
GenBank Accession NumberBC000375
Gene Symbol Chromogranin B
Gene ID (NCBI) 1114
RRIDAB_2081138
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP05060
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Chromogranin B is also named as Secretogranin-1, SgI, CgB, CHGB and SCG1. CHGB, a secretory granule protein, inserts itself into membrane and forms a chloride-conducting channel (PMID: 30456382). Native CHGB distributes nearly equally in soluble and membrane-bound forms, and both reconstitute highly selective anion channels in membrane (PMID: 37435575). The calculated molecular weight of Chromogranin B is at 78kDa. It has been shown that CHGB has a clear degradation band at ~50 kDa (https://www.biorxiv.org/content/10.1101/2019.12.28.890053v1.full.pdf).

Protocols

Product Specific Protocols
FC protocol for Chromogranin B antibody 14968-1-APDownload protocol
IF protocol for Chromogranin B antibody 14968-1-APDownload protocol
IHC protocol for Chromogranin B antibody 14968-1-APDownload protocol
WB protocol for Chromogranin B antibody 14968-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Adv Sci (Weinh)

Identification of PRDX5 as A Target for The Treatment of Castration-Resistant Prostate Cancer

Authors - Rong Wang

J Cell Sci

PMID: 31182646

Authors - Shelby C Bearrows
humanWB

J Virol

Kaposi's Sarcoma-Associated Herpesvirus Infection Induces the Expression of Neuroendocrine Genes in Endothelial Cells.

Authors - Mohanan Valiya Veettil
humanWB

J Proteome Res

Label-Free LC-MS/MS Proteomic Analysis of Cerebrospinal Fluid Identifies Protein/Pathway Alterations and Candidate Biomarkers for Amyotrophic Lateral Sclerosis.

Authors - Mahlon Angus Collins
mouseWB

Biosci Biotechnol Biochem

Identification of proteins that bind to the neuroprotective agent neoechinulin A.

Authors - Shinji Kamisuki
  • KD Validated
mouseIF

mBio

Citrobacter rodentium Infection Induces Persistent Molecular Changes and Interferon Gamma-Dependent Major Histocompatibility Complex Class II Expression in the Colonic Epithelium.

Authors - Caroline Mullineaux-Sanders

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Patricia (Verified Customer) (05-15-2025)

I used the antibody to stain cells within the Islets of Langerhans in pancreatic tissue from organ donors, and it worked very well in combination with AF647.

  • Applications: Immunohistochemistry
  • Primary Antibody Dilution: 1:700
  • Cell Tissue Type: Human pancras
Chromogranin B Antibody Immunohistochemistry validation (1:700 dilution) in Human pancras (Cat no:14968-1-AP)
FH

Julia (Verified Customer) (03-14-2022)

Works very well after 1 hour incubation in PBS-T supplemented with normal donkey serum (secondary also added for an hour). Very clear staining.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:50
  • Cell Tissue Type: Mouse colonic tissue
Loading...
||
New chat

Able

正在加载,请稍候...