CORO1A Polyclonal antibody

CORO1A Polyclonal Antibody for WB, IHC, IF-P, IF-Fro, FC (Intra), IP, ELISA

Cat No. 17760-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, IF-Fro, FC (Intra), IP, ELISA

CLABP, Clipin A, CLIPINA, Clipin-A, CORO1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse brain tissue, HL-60 cells, Jurkat cells, mouse spleen tissue, rat brain tissue, rat spleen tissue, mouse thymus tissue, rat thymus tissue
Positive IP detected inmouse brain tissue, mouse spleen tissue
Positive IHC detected inrat spleen tissue, mouse spleen tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse spleen tissue, mouse colon tissue
Positive IF-Fro detected inmouse spleen tissue
Positive FC (Intra) detected inJurkat cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Immunofluorescence (IF)-FROIF-FRO : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

17760-1-AP targets CORO1A in WB, IHC, IF-P, IF-Fro, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag12139

Product name: Recombinant human CORO1A protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-461 aa of BC110374

Sequence: MSRQVVRSSKFRHVFGQPAKADQCYEDVRVSQTTWDSGFCAVNPKFVALICEASGGGAFLVLPLGKTGRVDKNAPTVCGHTAPVLDIAWCPHNDNVIASGSEDCTVMVWEIPDGGLMLPLREPVVTLEGHTKRVGIVAWHTTAQNVLLSAGCDNVIMVWDVGTGAAMLTLGPEVHPDTIYSVDWSRDGGLICTSCRDKRVRIIEPRKGTVVAEKDRPHEGTRPVRAVFVSEGKILTTGFSRMSERQVALWDTKHLEEPLSLQELDTSSGVLLPFFDPDTNIVYLCGKGDSSIRYFEITSEAPFLHYLSMFSSKESQRGMGYMPKRGLEVNKCEIARFYKLHERRCEPIAMTVPRKSDLFQEDLYPPTAGPDPALTAEEWLGGRDAGPLLISLKDGYVPPKSRELRVNRGLDTGRRRAAPEASGTPSSDAVSRLEEEMRKLQATVQELQKRLDRLEETVQAK

Predict reactive species
Full Name coronin, actin binding protein, 1A
Calculated Molecular Weight 461 aa, 51 kDa
Observed Molecular Weight 57 kDa
GenBank Accession NumberBC110374
Gene Symbol CORO1A
Gene ID (NCBI) 11151
RRIDAB_2082070
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP31146
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CORO1A also known as TACO, belongs to the WD repeat coronin family. CORO1A is recruited to phagosomes and actively retained by surviving mycobacteria and is usually released before phagosome fusion with or maturation into lysosomes. CORO1A is expressed in the brain, thymus, spleen, bone marrow, and lymph nodes. Mutations in CORO1A cause Immunodeficiency 8 with lymphoproliferation (IMD8)(PMID: 10338208).

Protocols

Product Specific Protocols
FC protocol for CORO1A antibody 17760-1-APDownload protocol
IF protocol for CORO1A antibody 17760-1-APDownload protocol
IHC protocol for CORO1A antibody 17760-1-APDownload protocol
IP protocol for CORO1A antibody 17760-1-APDownload protocol
WB protocol for CORO1A antibody 17760-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle

Br J Pharmacol

PMID: 27128203

Authors - Xianrong Zhang
humanWB

Int Immunopharmacol

Carbamazepine-modified HLA-A*24:02-bound peptidome: Implication of CORO1A in skin rash.

Authors - Fuli Min
humanWB

Front Med (Lausanne)

MCC Regulator of WNT Signaling Pathway (MCC) Is a Podocyte Essential Gene.

Authors - Hui Song
ratWB

PLoS One

Repetitive Transcranial Magnetic Stimulation Promotes Neural Stem Cell Proliferation via the Regulation of MiR-25 in a Rat Model of Focal Cerebral Ischemia.

Authors - Feng Guo
mouseWB,IP

Redox Biol

Coronin 1a-mediated F-actin disassembly controls effector function in murine neutrophils

Authors - Anton Shaverskyi

Biomolecules

Role of CORO1A in Regulating Immune Homeostasis of Mammary Glands and Its Contribution to Clinical Mastitis Development in Dairy Cows

Authors - Bohao Zhang

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Jordan (Verified Customer) (12-04-2024)

Antibody worked well for western blot at 1:1000 overnight.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: 293T
FH

lucie (Verified Customer) (06-25-2024)

Anti-CORO1A working in immunofluorescence on neutrophils fixed with PFA 2%, at a dilution of 1/200 in BSA 1%.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1/200
  • Cell Tissue Type: Neutrophils
Loading...
||
New chat

Able

正在加载,请稍候...