Tested Applications
| Positive WB detected in | mouse brain tissue, HL-60 cells, Jurkat cells, mouse spleen tissue, rat brain tissue, rat spleen tissue, mouse thymus tissue, rat thymus tissue |
| Positive IP detected in | mouse brain tissue, mouse spleen tissue |
| Positive IHC detected in | rat spleen tissue, mouse spleen tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse spleen tissue, mouse colon tissue |
| Positive IF-Fro detected in | mouse spleen tissue |
| Positive FC (Intra) detected in | Jurkat cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Immunofluorescence (IF)-FRO | IF-FRO : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 5 publications below |
| IF | See 1 publications below |
| IP | See 1 publications below |
Product Information
17760-1-AP targets CORO1A in WB, IHC, IF-P, IF-Fro, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag12139 Product name: Recombinant human CORO1A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-461 aa of BC110374 Sequence: MSRQVVRSSKFRHVFGQPAKADQCYEDVRVSQTTWDSGFCAVNPKFVALICEASGGGAFLVLPLGKTGRVDKNAPTVCGHTAPVLDIAWCPHNDNVIASGSEDCTVMVWEIPDGGLMLPLREPVVTLEGHTKRVGIVAWHTTAQNVLLSAGCDNVIMVWDVGTGAAMLTLGPEVHPDTIYSVDWSRDGGLICTSCRDKRVRIIEPRKGTVVAEKDRPHEGTRPVRAVFVSEGKILTTGFSRMSERQVALWDTKHLEEPLSLQELDTSSGVLLPFFDPDTNIVYLCGKGDSSIRYFEITSEAPFLHYLSMFSSKESQRGMGYMPKRGLEVNKCEIARFYKLHERRCEPIAMTVPRKSDLFQEDLYPPTAGPDPALTAEEWLGGRDAGPLLISLKDGYVPPKSRELRVNRGLDTGRRRAAPEASGTPSSDAVSRLEEEMRKLQATVQELQKRLDRLEETVQAK Predict reactive species |
| Full Name | coronin, actin binding protein, 1A |
| Calculated Molecular Weight | 461 aa, 51 kDa |
| Observed Molecular Weight | 57 kDa |
| GenBank Accession Number | BC110374 |
| Gene Symbol | CORO1A |
| Gene ID (NCBI) | 11151 |
| RRID | AB_2082070 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P31146 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CORO1A also known as TACO, belongs to the WD repeat coronin family. CORO1A is recruited to phagosomes and actively retained by surviving mycobacteria and is usually released before phagosome fusion with or maturation into lysosomes. CORO1A is expressed in the brain, thymus, spleen, bone marrow, and lymph nodes. Mutations in CORO1A cause Immunodeficiency 8 with lymphoproliferation (IMD8)(PMID: 10338208).
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for CORO1A antibody 17760-1-AP | Download protocol |
| IF protocol for CORO1A antibody 17760-1-AP | Download protocol |
| IHC protocol for CORO1A antibody 17760-1-AP | Download protocol |
| IP protocol for CORO1A antibody 17760-1-AP | Download protocol |
| WB protocol for CORO1A antibody 17760-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Int Immunopharmacol Carbamazepine-modified HLA-A*24:02-bound peptidome: Implication of CORO1A in skin rash. | ||
Front Med (Lausanne) MCC Regulator of WNT Signaling Pathway (MCC) Is a Podocyte Essential Gene. | ||
PLoS One Repetitive Transcranial Magnetic Stimulation Promotes Neural Stem Cell Proliferation via the Regulation of MiR-25 in a Rat Model of Focal Cerebral Ischemia. | ||
Redox Biol Coronin 1a-mediated F-actin disassembly controls effector function in murine neutrophils | ||
Biomolecules Role of CORO1A in Regulating Immune Homeostasis of Mammary Glands and Its Contribution to Clinical Mastitis Development in Dairy Cows |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Jordan (Verified Customer) (12-04-2024) | Antibody worked well for western blot at 1:1000 overnight.
|
FH lucie (Verified Customer) (06-25-2024) | Anti-CORO1A working in immunofluorescence on neutrophils fixed with PFA 2%, at a dilution of 1/200 in BSA 1%.
|

































