Tested Applications
| Positive WB detected in | mouse heart tissue, U2OS cells, rat heart tissue, mouse skeletal muscle tissue, rat skeletal muscle tissue |
| Positive IP detected in | U2OS cells |
| Positive IHC detected in | mouse heart tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | U2OS cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 15 publications below |
| IHC | See 1 publications below |
| IF | See 2 publications below |
| IP | See 1 publications below |
| ELISA | See 1 publications below |
Product Information
15808-1-AP targets Alpha B Crystallin in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, fish |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag8543 Product name: Recombinant human aB-Crystallin protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-175 aa of BC007008 Sequence: MDIAIHHPWIRRPFFPFHSPSRLFDQFFGEHLLESDLFPTSTSLSPFYLRPPSFLRAPSWFDTGLSEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPERTIPITREEKPAVTAAPKK Predict reactive species |
| Full Name | crystallin, alpha B |
| Calculated Molecular Weight | 175 aa, 20 kDa |
| Observed Molecular Weight | 20-22 kDa |
| GenBank Accession Number | BC007008 |
| Gene Symbol | Alpha B Crystallin |
| Gene ID (NCBI) | 1410 |
| RRID | AB_2292175 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P02511 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Alpha B-crystallin, encoded by CRYAB gene, is multifunctional, serving as both a major structural protein in the lens and a small heat-shock protein in other tissues in mammals. Alpha B-crystallin may contribute to the transparency and refractive index of the lens. Single nucleotide polymorphisms (SNPs) in the promoter region of CRYAB gene have been associated with in multiple sclerosis. Mutations in the CRYAB gene cause distinct clinical phenotypes including isolated posterior polar cataract, myofibrillar myopathy, cardiomyopathy, or a multisystemic disorder combining all these features. Impairment of alpha-B crystallin dimerization may be relevant to the pathogenesis of these disorders.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Alpha B Crystallin antibody 15808-1-AP | Download protocol |
| IHC protocol for Alpha B Crystallin antibody 15808-1-AP | Download protocol |
| IP protocol for Alpha B Crystallin antibody 15808-1-AP | Download protocol |
| WB protocol for Alpha B Crystallin antibody 15808-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Brief Bioinform iSMNN: batch effect correction for single-cell RNA-seq data via iterative supervised mutual nearest neighbor refinement. | ||
Oxid Med Cell Longev Resveratrol Modulation of Protein Expression in parkin-Mutant Human Skin Fibroblasts: A Proteomic Approach. | ||
Elife Conservation and divergence of myelin proteome and oligodendrocyte transcriptome profiles between humans and mice. | ||
Glia Developmental maturation and regional heterogeneity but no sexual dimorphism of the murine CNS myelin proteome | ||
Front Cell Dev Biol A Novel Ferroptosis-Related Prognostic Signature Reveals Macrophage Infiltration and EMT Status in Bladder Cancer.
| ||
Food Res Int Inhibitory effect of edible natural compounds with di- and tri-carboxyl moiety on endogenous protease inducing disassembly and degradation of myofibrils from grass carp (Ctenopharyngodon idella). |











