Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

CTHRC1 Polyclonal antibody

CTHRC1 Polyclonal Antibody for WB, IF/ICC, FC (Intra), IP, ELISA

Cat No. 16534-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA

collagen triple helix repeat containing 1, Collagen triple helix repeat-containing protein 1, Protein NMTC1, UNQ762/PRO1550

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse brain tissue, A375 cells, Jurkat cells, mouse lung tissue, rat brain tissue
Positive IP detected inA375 cells
Positive IF/ICC detected inA375 cells, HepG2 cells
Positive FC (Intra) detected inA375 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:16000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.13 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

16534-1-AP targets CTHRC1 in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag9812

Product name: Recombinant human CTHRC1 protein

Source: e coli.-derived, T-HIS

Tag: 6*His

Domain: 1-243 aa of BC014245

Sequence: MRPQGPAASPQRLRGLLLLLLLQLPAPSSASEIPKGKQKAQLRQREVVDLYNGMCLQGPAGVPGRDGSPGANGIPGTPGIPGRDGFKGEKGECLRESFEESWTPNYKQCSWSSLNYGIDLGKIAECTFTKMRSNSALRVLFSGSLRLKCRNACCQRWYFTFNGAECSGPLPIEAIIYLDQGSPEMNSTINIHRTSSVEGLCEGIGAGLVDVAIWVGTCSDYPKGDASTGWNSVSRIIIEELPK

Predict reactive species
Full Name collagen triple helix repeat containing 1
Calculated Molecular Weight 243 aa, 26 kDa
Observed Molecular Weight 25-30 kDa
GenBank Accession NumberBC014245
Gene Symbol CTHRC1
Gene ID (NCBI) 115908
RRIDAB_2087511
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ96CG8
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Collagen triple helix repeat-containing protein 1 (CTHRC1), also known as protein NMTC1, is a glycosylated secreted protein. CTHRC1 was identified as a novel molecular in injured and diseased arteries where it may contribute to vascular remodeling by limiting collagen matrix deposition and promoting cell migration (PMID: 15618538). It has been reported that CTHRC1 is a positive regulator of osteoblastic bone formation (PMID: 18779865). Besides, studies reveal that CTHRC1 expression is implicated in various malignancies, including hepatocellular carcinoma, gastric carcinoma, colon cancer, and lung cancer (PMID: 23922981; 24504172; 24746208; 25139095).

Protocols

Product Specific Protocols
FC protocol for CTHRC1 antibody 16534-1-APDownload protocol
IF protocol for CTHRC1 antibody 16534-1-APDownload protocol
IP protocol for CTHRC1 antibody 16534-1-APDownload protocol
WB protocol for CTHRC1 antibody 16534-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
humanIF

Theranostics

Single-cell landscape reveals active cell subtypes and their interaction in the tumor microenvironment of gastric cancer.

Authors - Yumin Li
humanWB,IF

J Transl Med

Single-cell and spatial transcriptome profiling reveal CTHRC1+ fibroblasts promote EMT through WNT5A signaling in colorectal cancer

Authors - Yunfei Lu
humanWB,IF

Respir Res

Pirfenidone attenuates lung fibrotic fibroblast responses to transforming growth factor-β1.

Authors - Jin Jin
humanWB

Int J Mol Sci

Identification of Overexpressed Genes in Malignant Pleural Mesothelioma.

Authors - Federica Morani
ratWB,IHC

J Cell Sci

miR-9 inhibits Schwann cell migration by targeting CTHRC1 following sciatic nerve injury.

Authors - Songlin Zhou
  • KD Validated
mouse,humanWB,IF

Inflammation

Collagen Triple Helix Repeat Containing 1 Deficiency Protects Against Airway Remodeling and Inflammation in Asthma Models In Vivo and In Vitro

Authors - Yong Feng
  • KD Validated

Reviews

    5.0 out of 5
Add a review

2 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Swati (Verified Customer) (09-26-2025)

The antibody shows a clear band at 28/30 kDa in WB with no background. Excellent.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000 (for WB)
  • Cell Tissue Type: Human/murine lung fibroblasts
CTHRC1 Antibody Western Blot validation (1:1000 (for WB) dilution) in Human/murine lung fibroblasts (Cat no:16534-1-AP)

Valeria (Verified Customer) (11-11-2020)

Fixative: 4% paraformaldehydeAntigen retrieval step: NoPermeabilization: Methanol gradient (70% for 10 mins, 95% for 10 mins, 100% for 20 mins, 95% for 10 mins, 70% for 10 mins)Protein blocking: 10% NGS diluted in TBSTEndogenous biotin blocking: Avidin D solution for 15 mins, Biotin for 15 mins (Vector Laboratories, Inc)Secondary antibody: Life tech/ThermoFisher, A11006, Alexa 488, Goat anti-Rabbit isotype IgG, 1:100

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:200
  • Cell Tissue Type: Human skeletal muscle sections (10um)
CTHRC1 Antibody Immunofluorescence validation (1:200 dilution) in Human skeletal muscle sections (10um) (Cat no:16534-1-AP)
Loading...
||
New chat

Able

正在加载,请稍候...