• Featured Product
  • KD/KO Validated

Cytochrome c Polyclonal antibody

Cytochrome c Polyclonal Antibody for WB, IHC, IF-P, FC (Intra), ELISA
Cat No. 10993-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (7)

Applications

WB, IHC, IF-P, FC (Intra), IP, ELISA

CYC, CYCS

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, mouse skeletal muscle tissue, rat skeletal muscle tissue, NIH/3T3 cells, rat liver tissue, HEK-293 cells, HepG2 cells, C2C12 cells, Jurkat cells, mouse kidney tissue, rat kidney tissue
Positive IHC detected inhuman liver tissue, human breast cancer tissue, human colon cancer tissue, mouse brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse eye tissue
Positive FC (Intra) detected inHepG2 cells

This antibody is not recommended for immunocytofluorescent assays.

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:8000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10993-1-AP targets Cytochrome c in WB, IHC, IF-P, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, pig, monkey, chicken, hamster, sheep, goat, hippospongia
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag1455

Product name: Recombinant human Cytochrome c protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-105 aa of BC009578

Sequence: MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIWGEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE

Predict reactive species
Full Name cytochrome c, somatic
Calculated Molecular Weight 12 kDa
Observed Molecular Weight 12-15 kDa
GenBank Accession NumberBC009578
Gene Symbol Cytochrome c
Gene ID (NCBI) 54205
RRIDAB_2090467
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP99999
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Cytochrome c is a 12-15 kDa electron transporting protein located in the inner mitochondrial membrane. As a part of respiratory chain, cytochrome c plays a critical role in the process of oxidative phosphorylation and ATP producing. Besides, cytochrome c also gets implicated in apoptosis process. Upon apoptotic stimulation, cytochrome c ca99n be released from mitochondria into cytoplasm, which is required for caspase-3 activation and the occurrence of apoptosis.

Protocols

Product Specific Protocols
FC protocol for Cytochrome c antibody 10993-1-APDownload protocol
IF protocol for Cytochrome c antibody 10993-1-APDownload protocol
IHC protocol for Cytochrome c antibody 10993-1-APDownload protocol
WB protocol for Cytochrome c antibody 10993-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Cell

Tau interactome maps synaptic and mitochondrial processes associated with neurodegeneration.

Authors - Tara E Tracy
humanWB,IF

Nat Commun

MYG1 drives glycolysis and colorectal cancer development through nuclear-mitochondrial collaboration

Authors - Jianxiong Chen
humanWB

Mol Cell

Filamentous GLS1 promotes ROS-induced apoptosis upon glutamine deprivation via insufficient asparagine synthesis.

Authors - Bin Jiang
humanWB

Adv Sci (Weinh)

Mitochondrial tRNAGlu 14693A>G Mutation, an "Enhancer" to the Phenotypic Expression of Leber's Hereditary Optic Neuropathy

Authors - Lihao Jin
rat,humanWB

Adv Sci (Weinh)

Hierarchical Targeting Nanodrug with Holistic DNA Protection for Effective Treatment of Acute Kidney Injury

Authors - Qiaohui Chen
mouseWB,IHC

Acta Pharm Sin B

Melatonin receptor 1a alleviates sleep fragmentation-aggravated testicular injury in T2DM by suppression of TAB1/TAK1 complex through FGFR1

Authors - Xiaohui Zhang

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Lucas (Verified Customer) (10-31-2025)

Successfully used in Western blot on mitochondrial fractions from mouse muscle. Produced strong and specific bands at a 1:1000 dilution.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Mouse muscle cells
FH

Kazu (Verified Customer) (12-14-2022)

Worked well for 4% PFA fixed mouse optic nerve using this antibody at dilution of 1:200. Little background observed.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Mouse optic nerve
FH

Azita (Verified Customer) (06-02-2021)

Western blot analysis using Cytochrome c polyclonal antibody in NSC34 cell line at dilution of 1:1000.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: NSC34
FH

Ying (Verified Customer) (04-22-2021)

good antibody. work well with mouse cells

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:4000
Cytochrome c Antibody Western Blot validation (1:4000 dilution) in (Cat no:10993-1-AP)
FH

Chi (Verified Customer) (09-26-2019)

The antibody works very well with good signal and low background.

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:2000
  • Cell Tissue Type: mouse embryonic fibroblasts
Cytochrome c Antibody Western Blot, validation (1:2000 dilution) in mouse embryonic fibroblasts (Cat no:10993-1-AP)
FH

Xiaoping (Verified Customer) (10-22-2018)

The signal is good and the size is between 10-15kDa.

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: mouse fibroblast
Cytochrome c Antibody Western Blot, validation (1:1000 dilution) in mouse fibroblast (Cat no:10993-1-AP)
Loading...
||
New chat Able
正在加载,请稍候...