Tested Applications
| Positive WB detected in | human brain tissue, mouse brain tissue, rat brain tissue |
| Positive IP detected in | mouse brain tissue |
| Positive IHC detected in | mouse brain tissue, human gliomas tissue, human kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive FC (Intra) detected in | Jurkat cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:300-1:1200 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
16011-1-AP targets CYFIP1/2 in WB, IHC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag8749 Product name: Recombinant human CYFIP2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 855-1253 aa of BC011762 Sequence: CYNGSTNRFVRTAIPFTQEPQRDKPANVQPYYLYGSKPLNIAYSHIYSSYRNFVGPPHFKTICRLLGYQGIAVVMEELLKIVKSLLQGTILQYVKTLIEVMPKICRLPRHEYGSPGILEFFHHQLKDIIEYAELKTDVFQSLREVGNAILFCLLIEQALSQEEVCDLLHAAPFQNILPRVYIKEGERLEVRMKRLEAKYAPLHLVPLIERLGTPQQIAIAREGDLLTKERLCCGLSMFEVILTRIRSYLQDPIWRGPPPTNGVMHVDECVEFHRLWSAMQFVYCIPVGTNEFTAEQCFGDGLNWAGCSIIVLLGQQRRFDLFDFCYHLLKVQRQDGKDEIIKNVPLKKMADRIRKYQILNNEVFAILNKYMKSVETDSSTVEHVRCFQPPIHQSLATTC Predict reactive species |
| Full Name | cytoplasmic FMR1 interacting protein 2 |
| Calculated Molecular Weight | 148 kDa |
| Observed Molecular Weight | 130 kDa |
| GenBank Accession Number | BC011762 |
| Gene Symbol | CYFIP2 |
| Gene ID (NCBI) | 26999 |
| RRID | AB_2090638 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q96F07 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CYFIP1/2 belongs to the CYFIP family and is involved in T-cell adhesion and p53-dependent induction of apoptosis. CYFIP1 contains 1,253 amino acids and shares 88% sequence identity with CYFIP2. CYFIP1 and CYFIP2 are members of a highly conserved protein family and share approximately 99% sequence identity with their mouse orthologs. CYFIP1 has been shown to interact with the small GTPase RAC1, which is implicated in development and maintenance of neuronal structures. Consistent with FMRP and RAC1 localization in dendritic fine structures, CYFIP1/2 are present in synaptosomal extracts. This antibody can recognize both CYFIP1 and CYFIP2.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for CYFIP1/2 antibody 16011-1-AP | Download protocol |
| IHC protocol for CYFIP1/2 antibody 16011-1-AP | Download protocol |
| IP protocol for CYFIP1/2 antibody 16011-1-AP | Download protocol |
| WB protocol for CYFIP1/2 antibody 16011-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The anti-GAPDH antibody (Cat# 16011-1-AP) has 3 total citations. These appear in Nature Communications, Scientific Reports, and Disease Markers. The research fields span neurodegenerative disease (ALS/FTD-associated C9orf72 repeat RNA and sporadic ALS biomarkers) and metabolic/immune pathology (diabetic nephropathy characterization and immune microenvironment analysis). Applications include Western blot and immunohistochemistry in human and mouse samples.
| Species | Application | Title |
|---|---|---|
Nat Commun Phenylalanine-tRNA aminoacylation is compromised by ALS/FTD-associated C9orf72 C4G2 repeat RNA | ||
Sci Rep Construction of a diagnostic model utilizing m7G regulatory factors for the characterization of diabetic nephropathy and the immune microenvironment | ||
Dis Markers Two potential biomarkers identified in mesenchymal stem cells and leukocytes of patients with sporadic amyotrophic lateral sclerosis. |
Reviews
What customers say
Both reviewers gave this antibody a perfect 5-star rating. One user confirmed it works well for Western Blot at a 1:1000 dilution in TBS-T with 5% BSA on neuronal cells. The other reported positive results using it for immunoprecipitation on fibroblasts. Overall, customers find this antibody reliable and effective across different applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Bourcier (Verified Customer) (09-23-2024) | good antibodies
|
Lisa (Verified Customer) (03-17-2022) | The antibody works well for WB. Dilution 1:1000 in TBS-T 5% BSA.
|























