Filter: AllWBIHCIF/ICCFC (Intra)

WB analysis using 27298-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 27298-1-AP (calreticulin antibody) at dilution of 1:60000 incubated at room temperature for 1.5 hours.
WB analysis of HeLa using 27298-1-AP
WB result of Calreticulin antibody (27298-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-Calreticulin transfected HeLa cells.
WB analysis using 27298-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 27298-1-AP (Calreticulin antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.
WB analysis using 27298-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 27298-1-AP (Calreticulin antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.
WB analysis of mouse skeletal muscle using 27298-1-AP
mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 27298-1-AP (calreticulin Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
IHC staining of human thyroid using 27298-1-AP
Immunohistochemical analysis of paraffin-embedded human thyroid tissue slide using 27298-1-AP (calreticulin Antibody) at dilution of 1:200 (under 10x lens).
IHC staining of human thyroid using 27298-1-AP
Immunohistochemical analysis of paraffin-embedded human thyroid tissue slide using 27298-1-AP (calreticulin Antibody) at dilution of 1:200 (under 40x lens).
IHC staining of human colon using 27298-1-AP
Immunohistochemical analysis of paraffin-embedded human normal colon slide using 27298-1-AP (calreticulin antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human colon using 27298-1-AP
Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 27298-1-AP (calreticulin antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IF Staining of HepG2 using 27298-1-AP
Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using Calreticulin antibody (27298-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red).
IF Staining of HeLa using 27298-1-AP
Immunofluorescent analysis of (4% PFA) fixed HeLa cells using Calreticulin antibody (27298-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidine (red).
IF Staining of HepG2 using 27298-1-AP
Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using calreticulin antibody (27298-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-phalloidin (red).
IF Staining of SKOV-3 using 27298-1-AP
Immunofluorescent analysis of (4% PFA) fixed SKOV-3 cells using Calreticulin antibody (27298-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).
FC experiment of HeLa using 27298-1-AP
1x10^6 HeLa cells were intracellularly stained with 0.4 ug calreticulin Polyclonal antibody (27298-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.4 ug Rabbit IgG control Rabbit PolyAb (30000-0-AP) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C).

Featured Product
KD/KO Validated

calreticulin Polyclonal antibody

Name: calreticulin Polyclonal antibody
Brand: Proteintech
SKU: 27298-1-AP

calreticulin Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), ELISA

Cat No. 27298-1-AP

Publications(73)

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, FC (Intra), ELISA

Synonyms

CALR, Calregulin, CRT

Formulation: PBS and Azide

PBS and Azide

Conjugate: Unconjugated

Unconjugated

CoraLite® Plus 555 CoraLite® Plus 647

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information
Publications (73)
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	HeLa cells, mouse skeletal muscle tissue, C6 cells, NIH/3T3 cells, mouse brain tissue, rat brain tissue, SH-SY5Y cells
Positive IHC detected in	human thyroid tissue, human normal colon **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***
Positive IF/ICC detected in	HepG2 cells, SKOV-3 cells, HeLa cells
Positive FC (Intra) detected in	HeLa cells

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:20000-1:100000
Immunohistochemistry (IHC)	IHC : 1:50-1:500
Immunofluorescence (IF)/ICC	IF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)	FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

WB	See 27 publications below
IHC	See 3 publications below
IF	See 45 publications below

Product Information

27298-1-AP targets calreticulin in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Cited Reactivity	human, mouse, rat, monkey
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag26064 Product name: Recombinant human calreticulin protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 248-417 aa of BC002500 Sequence: KKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDPSIYAYDNFGVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRLKEEEEDKKRKEEEEAEDKEDDEDKDEDEEDEEDKEEDEEEDVPGQAKDEL Predict reactive species
Full Name	calreticulin
Calculated Molecular Weight	60 kDa
Observed Molecular Weight	55 kDa
GenBank Accession Number	BC002500
Gene Symbol	Calreticulin
Gene ID (NCBI)	811
RRID	AB_2880835
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	P27797
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CALR,also named as grp60, ERp60, HACBP, CRP55, CRTC and Calregulin, belongs to the calreticulin family. It is a molecular calcium-binding chaperone promoting folding, oligomeric assembly and quality control in the ER via the calreticulin/calnexin cycle. CALR is a ER marker. It interacts transiently with almost all of the monoglucosylated glycoproteins that are synthesized in the ER. CALR interacts with the DNA-binding domain of NR3C1 and mediates its nuclear export. The MW of CALR migrates aberrantly at 60 kD by SDS-PAGE. Some study provided that it's a new possibility for CRT-mediated tumor immune prevention and treatment.

Protocols

Product Specific Protocols
WB protocol for calreticulin antibody 27298-1-AP	Download protocol
IHC protocol for calreticulin antibody 27298-1-AP	Download protocol
IF protocol for calreticulin antibody 27298-1-AP	Download protocol
FC protocol for calreticulin antibody 27298-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

Species	Application	Title
human	WB	Cell Metab Transient Receptor Potential V Channels Are Essential for Glucose Sensing by Aldolase and AMPK. Authors - Mengqi Li View Article
mouse	IF	Nat Commun In situ generation of micrometer-sized tumor cell-derived vesicles as autologous cancer vaccines for boosting systemic immune responses Authors - Yuxin Guo View Article
mouse	IF	Nat Commun Engineered macrophages as near-infrared light activated drug vectors for chemo-photodynamic therapy of primary and bone metastatic breast cancer. Authors - Yanjuan Huang View Article
human	WB	EMBO J STING directly recruits WIPI2 for autophagosome formation during STING-induced autophagy Authors - Wei Wan View Article
mouse		J Control Release Positron emission tomography guided synergistic treatment of melanoma using multifunctional zirconium-hematoporphyrin nanosonosensitizers Authors - Xiaodan Jiao View Article
mouse,human	WB,IF	ACS Appl Mater Interfaces A Versatile Nanoplatform for Broad-Spectrum Immunotherapy by Reversing the Tumor Microenvironment Authors - Ao Chen View Article