Filter: AllWBIPIHCIF/ICCFC (Intra)

WB analysis using 22373-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 22373-1-AP (DCP1A antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.
WB analysis of mouse brain using 22373-1-AP
mouse brain tissue were subjected to SDS PAGE followed by western blot with 22373-1-AP (DCP1A antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
WB analysis of mouse lung using 22373-1-AP
mouse lung tissue were subjected to SDS PAGE followed by western blot with 22373-1-AP (DCP1A antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
WB analysis of Jurkat using 22373-1-AP
Jurkat cells were subjected to SDS PAGE followed by western blot with 22373-1-AP (DCP1A antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
IP experiment of mouse brain using 22373-1-AP
IP result of anti-DCP1A (IP:22373-1-AP, 4ug; Detection:22373-1-AP 1:3000) with mouse brain tissue lysate 3200ug.
IHC staining of mouse lung using 22373-1-AP
Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 22373-1-AP (DCP1A Antibody) at dilution of 1:50 (under 40x lens).
IHC staining of mouse lung using 22373-1-AP
Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 22373-1-AP (DCP1A Antibody) at dilution of 1:50 (under 10x lens).
IF Staining of HepG2 using 22373-1-AP
Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using DCP1A antibody (22373-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red).
IF Staining of HepG2 using 22373-1-AP
Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using DCP1A antibody (22373-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red).
FC experiment of HeLa using 22373-1-AP
1X10^6 HeLa cells were intracellularly stained with 0.4 ug Anti-Human DCP1A (22373-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Isotype Control. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

DCP1A Polyclonal antibody

Name: DCP1A Polyclonal antibody
Brand: Proteintech
SKU: 22373-1-AP
Rating: 5.00 (2 reviews)

DCP1A Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Cat No. 22373-1-AP

Publications(12)

Reviews (2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), IP, RIP, ELISA

Synonyms

EC:3.6.1.62, HSA275986, mRNA decapping enzyme 1A, mRNA-decapping enzyme 1A, Nbla00360

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

CoraLite® Plus 488

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information
Publications (12)
Protocols
Reviews (2)

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	HEK-293 cells, mouse brain tissue, mouse lung tissue, Jurkat cells, MCF-7 cells, rat brain tissue
Positive IP detected in	mouse brain tissue
Positive IHC detected in	mouse lung tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***
Positive IF/ICC detected in	HepG2 cells
Positive FC (Intra) detected in	HeLa cells

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:2000-1:10000
Immunoprecipitation (IP)	IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)	IHC : 1:20-1:200
Immunofluorescence (IF)/ICC	IF/ICC : 1:200-1:800
Flow Cytometry (FC) (INTRA)	FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

WB	See 8 publications below
IF	See 5 publications below
IP	See 1 publications below
RIP	See 2 publications below

Product Information

22373-1-AP targets DCP1A in WB, IHC, IF/ICC, FC (Intra), IP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Cited Reactivity	human, mouse
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag18027 Product name: Recombinant human DCP1A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-350 aa of BC007439 Sequence: MEALSRAGQEMSLAALKQHDPYITSIADLTGQVALYTFCPKANQWEKTDIEGTLFVYRRSASPYHGFTIVNRLNMHNLVEPVNKDLEFQLHEPFLLYRNASLSIYSIWFYDKNDCHRIAKLMADVVEEETRRSQQAARDKQSPSQANGCSDHRPIDILEMLSRAKDEYERNQMGDSNISSPGLQPSTQLSNLGSTETLEEMPSGSQDKSAPSGHKHLTVEELFGTSLPKEQPAVVGLDSEEMERLPGDASQKEPNSFLPFPFEQLGGAPQSETLGVPSAAHHSVQPEITTPVLITPASITQSNEKHAPTYTIPLSPVLSPTLPAEAPTAQVPPSLPRNSTMMQAVKTTPR Predict reactive species
Full Name	DCP1 decapping enzyme homolog A (S. cerevisiae)
Calculated Molecular Weight	582 aa, 63 kDa
Observed Molecular Weight	70 kDa
GenBank Accession Number	BC007439
Gene Symbol	DCP1A
Gene ID (NCBI)	55802
RRID	AB_2879092
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen Affinity purified
UNIPROT ID	Q9NPI6
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DCP1 decapping enzyme homolog A (S. cerevisiae), known as mRNA-decapping enzyme 1A (DCP1A),is necessary for the degradation of mRNAs, both in normal mRNA turnover and in nonsense-mediated mRNA decay. Removes the 7-methyl guanine cap structure from mRNA molecules, yielding a 5'-phosphorylated mRNA fragment and 7m-GDP. Contributes to the transactivation of target genes after stimulation by TGFB1. This antibody specifically react with the 70kd DCP1A protein.

Protocols

Product Specific Protocols
IF protocol for DCP1A antibody 22373-1-AP	Download protocol
IHC protocol for DCP1A antibody 22373-1-AP	Download protocol
IP protocol for DCP1A antibody 22373-1-AP	Download protocol
WB protocol for DCP1A antibody 22373-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

Species	Application	Title
human	RIP	Cell Rep Vault RNAs aid RNA virus infection by facilitating cytoplasmic localization of hnRNP C and ELAVL1 Authors - Jorn E Stok View Article
human	WB,IF	FEBS Lett Gemin5 plays a role in unassembled-U1 snRNA disposal in SMN-deficient cells. Authors - Dongxu Jiang View Article
human	WB,IF	Cell Rep DIAPH3 condensates formed by liquid-liquid phase separation act as a regulatory hub for stress-induced actin cytoskeleton remodeling Authors - Ke Zhang View Article
mouse	IP,IF	Cell Rep The proteome and transcriptome of stress granules and P bodies during human T lymphocyte activation Authors - Nicolas Curdy View Article
human	WB	J Thorac Dis LncRNA HOXD-AS2 regulates miR-3681-5p/DCP1A axis to promote the progression of non-small cell lung cancer Authors - Yuanyuan Zhang View Article
human	WB,IF	J Cell Biol DDX6 modulates P-body and stress granule assembly, composition, and docking Authors - Nina Ripin View Article

Reviews

Add a review

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

FH Laurens (Verified Customer) (02-02-2024)	Works well for ICC with bright stain and no background, shown with green channel in image. Applications: Immunofluorescence Primary Antibody Dilution: 1:500 Cell Tissue Type: A549 cells, U2OS cells, HEK293 cells DCP1A Antibody Immunofluorescence validation (1:500 dilution) in A549 cells, U2OS cells, HEK293 cells (Cat no:22373-1-AP)
FH Tatyana (Verified Customer) (12-04-2023)	Detects P-bodies in ICC, good signal Applications: Immunofluorescence Primary Antibody Dilution: 1:1000 Cell Tissue Type: Human / HeLa cells DCP1A Antibody Immunofluorescence validation (1:1000 dilution) in Human / HeLa cells (Cat no:22373-1-AP)