• Featured Product
  • KD/KO Validated

DDX20 Polyclonal antibody

DDX20 Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, ELISA
Cat No. 11324-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Component of gems 3, DEAD box protein 20, DEAD box protein DP 103, DP103, EC:3.6.1.15

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293T cells, Jurkat cells, mouse testis tissue, HeLa cells
Positive IP detected inHeLa cells
Positive IHC detected inhuman breast cancer tissue, human colon cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells, Hela cells
Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:20-1:200
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

11324-1-AP targets DDX20 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag1863

Product name: Recombinant human DDX20 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 520-824 aa of BC011556

Sequence: SHSECGIIEKATSPKELGCDRQSEEQMKNSVQTPVENSTNSQHQVKEALPVSLPQIPCLSSFKIHQPYTLTFAELVEDYEHYIKEGLEKPVEIIRHYTGPGDQTVNPQNGFVRNKVTEQRVPVLASSSQSGDSESDSDSYSSRTSSQSKGNKSYLEGSSDNQLKDSESTPVDDRISLEQPPNGSDTPNPEKYQESPGIQMKTRLKEGASQRAKQSRRNLPRRSSFRLQTEAQEDDWYDCHREIRLSFSDTYQDYEEYWRAYYRAWQEYYAAASHSYYWNAQRHPSWMAAYHMNTIYLQEMMHSNQ

Predict reactive species
Full Name DEAD (Asp-Glu-Ala-Asp) box polypeptide 20
Calculated Molecular Weight 824 aa, 92 kDa
Observed Molecular Weight 100 kDa
GenBank Accession NumberBC011556
Gene Symbol DDX20
Gene ID (NCBI) 11218
RRIDAB_2092401
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9UHI6
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DEAD (Asp-Glu-Ala-Asp) box polypeptide 20 (DDX20), also known as DP103 or Gemin3, is a member of the DEAD box protein family expressed ubiquitously. DEAD family proteins use energy from ATP hydrolysis for RNA chaperoning and RNPase activity (PMID: 27121695). As a core member of the survival motor neuron (SMN) complex, DDX20 participate in small nuclear ribonucleoprotein (snRNP) biogenesis. Second, DDX20 have direct roles in gene expression in view of its implication in transcription and post-transcriptional gene silencing. Addition, the false expression of DDX20 could have deleterious effects on cellular homeostasis thus leading to cancer development and progression (PMID:29523774). Anymore, DDX20 could be identified as a biomarker and metastasis-driving oncogene of human breast cancer (PMID: 25083991). The detected weight of DDX20 is slightly higher than the theoretical molecular weight that is because of phosphorylation after translation.

Protocols

Product Specific Protocols
IF protocol for DDX20 antibody 11324-1-APDownload protocol
IHC protocol for DDX20 antibody 11324-1-APDownload protocol
IP protocol for DDX20 antibody 11324-1-APDownload protocol
WB protocol for DDX20 antibody 11324-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB,IHC

J Clin Invest

DEAD-box helicase DP103 defines metastatic potential of human breast cancers.

Authors - Eun Myoung Shin
  • KD Validated
mouseWB,IHC,IF

Dev Cell

DDX20 is required for cell-cycle reentry of prospermatogonia and establishment of spermatogonial stem cell pool during testicular development in mice

Authors - Dingfeng Zou
humanIHC

Aging (Albany NY)

An artificial neural network model to diagnose non-obstructive azoospermia based on RNA-binding protein-related genes

Authors - Fan Peng
humanWB

Comput Struct Biotechnol J

Analysis of the expression, function, prognosis and co-expression genes of DDX20 in gastric cancer.

Authors - Qingshui Wang
humanIHC

Arthritis Res Ther

Integrating transcriptome-wide study and mRNA expression profiles yields novel insights into the biological mechanism of chondropathies.

Authors - Ping Li
WB

Biosci Rep

FOXL2 Down-regulates Vitellogenin Expression at Mature Stage in Eriocheir sinensis.

Authors - Qing Li
Loading...
||
New chat Able
正在加载,请稍候...